KEGG   Cupriavidus metallidurans: Rmet_5330
Entry
Rmet_5330         CDS       T00351                                 
Symbol
zneB
Name
(GenBank) membrane fusion protein (MFP-RND) heavy metal cation tricomponent efflux HmxB (CzcB-like)
  KO
K15727  membrane fusion protein, heavy metal efflux system
Organism
rme  Cupriavidus metallidurans
Brite
KEGG Orthology (KO) [BR:rme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rme02000]
    Rmet_5330 (zneB)
Transporters [BR:rme02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   Rmet_5330 (zneB)
SSDB
Motif
Pfam: HlyD_D23 HlyD_3 Biotin_lipoyl_2 CusB_dom_1 PYNP_C PTS_EIIA_1 Biotin_lipoyl
Other DBs
NCBI-ProteinID: ABF12189
UniProt: Q1LCD7
Structure
Position
megaplasmid:complement(2042082..2043239)
AA seq 385 aa
MKNKPAFPGRVVYWLAAAVILGLGGAGVWTMRAKAEQKRADPPVALRHEGERLVVPAESP
LRRTLAVAPATRETVAAPFNLPAMIEADPAKLVKVLPPLAGRIVSLNKQLGDEVKAGDVL
FTIDSADLAQANSDAAKARAAMTMARRNLDRQRELDKSEIAAKRDFEQAQSDYDQAASES
QRADARLAQLGAKGGGTLQAGGGHILAVRSPINGRVVDLNAATGAYWNDTTASLMTVADL
SHVFVTANAQEKDLGHVYVGQSATVKFDAYDDPQPGKVRYVGQILDADTRTTKVRMVFDN
PDGRLRPGMFAQATFLSQPHEGIVVPMSAIVQSGFYTRAFVEVAPWQFEPRVIKLGAQIG
DRMEVKSGLSAGDRVVVKEGVLLND
NT seq 1158 nt   +upstreamnt  +downstreamnt
atgaaaaacaagccagcctttcccgggcgcgttgtctactggcttgccgcggcggtcata
ctgggtctcggcggtgctggtgtctggacgatgcgcgccaaggccgaacagaagcgcgcg
gacccgcccgtcgccctgcgtcatgaaggcgagcgcctggtagtcccggccgagtcgcca
ttgcgccgcaccttggccgtcgcgcccgccacgcgcgaaaccgtggctgcaccgttcaat
ctgccggccatgatcgaagccgatccggccaagctcgtgaaagtgctgccgccgctggcc
ggccgtatcgtcagcctgaacaagcagcttggcgacgaggtcaaggctggcgacgtgctg
ttcacgatcgattcggccgatctcgcgcaggccaacagcgacgccgccaaggcccgcgcg
gccatgacaatggcacgccgcaacctggatcgtcagcgggaactggacaagtcagagatc
gccgcaaagcgcgacttcgagcaggcccagagcgactatgaccaggccgccagcgaatcc
cagcgcgccgatgcgcgtctggcgcaacttggcgccaagggtggcggcacgttgcaggcg
ggcggcggccacatcctggccgtgcgatcgccgatcaacgggcgcgtggtcgatctcaat
gccgcgaccggcgcgtattggaacgacaccacggcctccctgatgaccgttgccgatctc
tcgcacgtgtttgtcacggccaacgcgcaggaaaaggatctgggccacgtgtatgtcggc
cagtcggccaccgtcaagttcgacgcctatgacgatccgcaaccgggcaaggtgcgctat
gtcgggcagatccttgatgcggacacgcgcacgaccaaggtgcgcatggtgttcgacaac
cccgacggacggctccgtcccggcatgttcgcgcaggctaccttcctgtcccagccgcat
gaaggcatcgtcgtgccgatgtcggccatcgtgcagagcggcttctacacccgcgcattc
gtcgaagtggcgccgtggcagttcgagccccgtgtgatcaagctcggcgcgcaaatcggc
gaccgtatggaagtgaagtcgggcctgtccgcgggagaccgcgtggtggtgaaggaaggg
gtgctgctgaatgattga

DBGET integrated database retrieval system