KEGG   Cupriavidus metallidurans: Rmet_5371
Entry
Rmet_5371         CDS       T00351                                 

Gene name
katG
Definition
(GenBank) catalase/hydroperoxidase HPI(I)
  KO
K03782  catalase-peroxidase [EC:1.11.1.21]
Organism
rme  Cupriavidus metallidurans
Pathway
rme00360  Phenylalanine metabolism
rme00380  Tryptophan metabolism
rme01100  Metabolic pathways
rme01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rme00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    Rmet_5371 (katG)
   00380 Tryptophan metabolism
    Rmet_5371 (katG)
Enzymes [BR:rme01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.21  catalase-peroxidase
     Rmet_5371 (katG)
SSDB
Motif
Pfam: peroxidase
Other DBs
NCBI-ProteinID: ABF12230
UniProt: Q1LC96
Position
megaplasmid:complement(2094936..2097116)
AA seq 726 aa
MTTEAKCPFLHPAGAGRALQEWWPERLNLHILRQNAPLSDPMGEAFDYAKAFNSLDLAAV
KKDLEALMTDSQSWWPADFGHYGPLFVRMAWHAAGTYRIGDGRGGAGAGQQRFAPTNSWP
DNVSLDKARRLIWPIKQKYGRKISWADLIVLTGNVALESMGFKTFGFGGGREDVYEPDES
VYWGNEAEWLADKRYSGNRNLENPLAAVQMGLIYVNPEGPNGNPDPVAAAIDIRETFRRM
AMNDEETVALIAGGHAFGKTHGAGPASHVGPEPEAAGLEEQGLGWRSSFGTGKGGDAIGS
GLEVIWTTTPTKWSNDFFKHLFEYEWELTKSPAGAHQWKPKGNAGAGTVPDPADPSKRRS
PSMLTTDLSLRFDSIYGKISRRYYDHPDELADAFARAWFKLTHRDMGPRARYLGPEVPKE
ELLWQDPIPPVDHPLIDAKDVAALKAKVQASGLTVPQLVSTAWASASTFRGSDKRGGANG
ARIRLAPQKDWDVNQPAELAKVLVKLESIQSEFNKAQSGGKKVSMADLIVLAGCAGVEQA
AKSAGQDVTVPFSPGRMDTTQEKTDLDAMVVLEPIADGFRNYLQGKFSVRAEALLVDKAQ
LLKLTVPEMTALVGGLRVLGANFGNSQHGVFTKRPGTLTNDFFVNLLDMGTEWKPVSEER
EVFEGSDRATGTPRWTGTRVDLVFGSNSELRAVAEVYGAADAQEKFVQDFVAAWSKVMNL
DRFDLK
NT seq 2181 nt   +upstreamnt  +downstreamnt
atgacaactgaagcaaagtgcccttttctacatcccgccggcgctggccgggcgctccag
gaatggtggcccgagcgcctgaatctgcatatcctgcgccagaacgctccgttgtccgat
ccgatgggagaggctttcgattatgcgaaggcgtttaacagtctcgacctcgcggcggtc
aagaaggatctggaagcgctgatgaccgattcgcagtcctggtggccggcggatttcggg
cactacggcccgttgttcgtccggatggcctggcacgcggcaggtacctaccgcatcggc
gatgggcgtggcggtgccggcgctggccagcagcgtttcgcgcccaccaacagctggccg
gacaacgtcagtctggacaaggcacgcaggctcatctggccgatcaagcagaaatacggc
cgcaagatctcgtgggccgacctgatcgttctgacgggcaatgttgccctggagtcgatg
gggttcaagaccttcggattcggcggcggacgcgaggatgtctatgagccggacgagtcc
gtctactggggcaatgaagccgagtggctggcggacaagcgttacagcggtaaccggaac
ctcgagaatccgctggctgcggtgcagatgggcctgatctatgtaaatccggaaggcccc
aatggcaacccggacccggttgccgccgccatcgacatccgcgagacgttccgccgcatg
gccatgaacgacgaagaaaccgtcgcgctgatcgcgggcggtcatgccttcggcaagacg
catggcgccggccccgcatcgcacgtggggcccgagcctgaagccgcgggcctcgaggag
cagggccttggctggcgcagcagctttggcaccggcaagggcggtgatgccatcggcagt
ggcctggaggtcatctggaccaccacgccgacgaagtggagcaacgacttcttcaagcac
ctgttcgagtacgaatgggaattgacgaagagccccgcgggcgcacatcaatggaagcca
aagggcaatgccggcgccggcaccgtgcccgaccctgccgacccgtcgaagcgccgttcg
ccctcgatgctgacgaccgatctgtcgctgcgcttcgattcgatctacggcaagatttcg
cgccggtactacgatcatcccgatgagctggccgacgcattcgcacgggcgtggttcaag
ctgacccatcgcgacatggggccgcgcgcgcgctaccttggcccggaagtcccgaaggag
gaactcctgtggcaagaccccatcccgccggttgatcatccgctgatcgacgcgaaggat
gtcgccgcgctcaaggccaaggtgcaggcttcggggctgaccgtgccgcaactggtttcg
acggcgtgggcgtcggcttcgacgttccgtggctcggacaagcgcggtggcgccaacggc
gcgcgcatccgcctggccccgcagaaggactgggacgtcaatcagcctgccgaactggcg
aaggtgctggtcaagctggagagcatccagagcgagttcaacaaggcgcagagcggtggc
aagaaggtctcgatggctgacctgatcgtgctggccggatgcgcgggcgtcgagcaggcg
gcaaagagcgccgggcaggatgtgacggtgccgttctcgccgggacgcatggacactacg
caggagaaaacggacctggatgcgatggtggtgctggaacccatcgcagatggtttccgc
aactacctgcagggcaagttctcggtccgggccgaggccttgctggtggacaaggcgcaa
ctgctgaagctgaccgtgccggagatgacggcgcttgtcggtggactgcgggtgctgggc
gccaacttcggcaactcgcagcacggcgtcttcacgaaacgccctggcacgctgaccaac
gacttcttcgtgaacctgctcgacatgggcacggagtggaagccagtgtcggaggaaaga
gaggtgttcgagggcagcgaccgggcgacgggcacgccaagatggaccggcacgcgcgtc
gatctggtcttcggctcgaactccgagctgcgggcggttgccgaggtctatggtgcggcg
gacgcgcaggagaagttcgtgcaggacttcgtggcggcgtggagcaaggtgatgaacctg
gaccgcttcgatctcaagtga

DBGET integrated database retrieval system