KEGG   Cupriavidus metallidurans: Rmet_6208
Entry
Rmet_6208         CDS       T00351                                 

Symbol
cnrC
Name
(GenBank) CnrC,Outer membrane protein, three components cation proton antiporter efflux system, involved in Co(II), Ni(II) resistance
  KO
K15725  outer membrane protein, heavy metal efflux system
Organism
rme  Cupriavidus metallidurans
Brite
KEGG Orthology (KO) [BR:rme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rme02000]
    Rmet_6208 (cnrC)
Transporters [BR:rme02000]
 Other transporters
  Pores ion channels [TC:1]
   Rmet_6208 (cnrC)
SSDB
Motif
Pfam: OEP
Other DBs
NCBI-ProteinID: ABF13067
UniProt: P37974
Position
pMOL28:54685..55941
AA seq 418 aa
MKQVISSFLCRPRFVGSAIWLLPVALSHAAEAPPFPNLLQQSLALAPAMVAQAANVRAAG
ADAAQAQAWLNPRIDTVLENLGAPSSDGLSQRQNTYSITQPFELGGKRGARIEVGERNFA
AAQARERQAQVAYAAELAVAYATAEAALGRKILATENLARANEELAAARALVDSGKEASL
RSAQAKASVAAAQAAEAAATNDATQALARLSAMSGASEPYTAVTSSLLTTQAVVPNAPAA
LAESPSVRAAEAERNALDAQVDVERKRWIPDVGVSAGVRRYGWTNSSGYVVGVTASIPLF
DQNRNGINAAVERVAAAQARLDSVRLEANVARQSAISQVATADKQLAAASEGEQAAAEAY
RMGRIGYESGKTPLMELLAVRRALVDARQLTIDARLARVRALAALAQADGRLAFEESR
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgaaacaggtgatctcctcgttcctttgtcgacctcgcttcgtcggctccgcaatatgg
ctgctgcccgttgcgttgagccacgctgccgaggcgcctccttttccgaacctgttgcag
caatcgcttgcactcgctccggcgatggtcgcgcaggccgccaatgttcgtgcggctggc
gccgatgctgctcaggcccaagcctggctgaatccgcgaatcgatacggtgcttgaaaac
cttggcgctcccagtagtgatgggctgagtcagcgccagaatacctattcgatcacgcag
cctttcgagctaggaggtaagcgcggcgcacggatcgaagttggcgaacgcaacttcgct
gcggcgcaagcacgggagcgtcaggcacaggtagcctacgccgccgaacttgcagtagcc
tatgcaacggctgaagcggcgctcggacgcaagatactggccacggaaaacctggcgcgt
gccaatgaagagttggcggccgcgcgtgcgttggtcgattccgggaaagaagccagcttg
cgcagcgcgcaggccaaggccagtgtggcggcggcgcaggccgcggaggcggcagccacc
aacgatgccacccaggctctggcgagattgtccgcgatgtccggcgcctccgaaccctat
acggccgtcacgagttccttgctgacgacccaggccgtcgtcccgaatgccccggcagca
ctcgccgagtctccgtcagtgcgggccgccgaagcggaacgcaatgcgctggatgctcaa
gttgacgtcgagaggaagcgctggattcctgatgttggcgtcagtgcgggcgtccgccgc
tatggctggaccaattccagtggctatgtggttggggtcacggcctccattccattgttc
gatcagaaccggaacggcatcaatgccgcggttgagcgggttgcagccgcccaagcgcgg
cttgacagcgtccggctcgaggccaacgtggcgcgccaatcggccatatcccaggtagcg
accgccgacaagcagctcgctgctgccagcgaaggagagcaggcggcggcagaagcctat
cgcatggggcgcattggctatgaatccggcaagacgccactgatggaattgctagcggtg
cggcgagcgctcgtcgacgcccggcaactgacgatcgatgcgcgcctggcgcgcgtgcgc
gccctggcggcgctggcacaggcggacggccgcctagcctttgaggaatcacgatga

DBGET integrated database retrieval system