KEGG   Cupriavidus metallidurans: Rmet_6298
Entry
Rmet_6298         CDS       T00351                                 
Symbol
trbN
Name
(GenBank) Soluble lytic murein transglycosylase
Organism
rme  Cupriavidus metallidurans
SSDB
Motif
Pfam: SLT SLT_3
Other DBs
NCBI-ProteinID: ABF13157
UniProt: Q5NV08
Position
pMOL28:complement(153689..154486)
AA seq 265 aa
MTKRLATLLIAVAASLGAQAATIEAVISPNAIVVKADGQARVHMLDGKPVLYCGLDAFLG
WSARLLGAQIEPGADDGPVVTLAGKATPIARLFTREGWLRPAVLNDAAQEALAERRGGWA
CAPKTEPFAQMGVRVDPKITAGIAMNESSYRGRPWPWTLNVSGRGMFFATREEAYAAVNR
LLANDRCDFDVGLMQVNWCYHGKRFASPWEALAPATNIRVAEDILAENLQRSGSAMKAVA
WYHSANPERGGPYFSRFMKHVAQFQ
NT seq 798 nt   +upstreamnt  +downstreamnt
gtgactaagcggcttgcgacgctcctgattgccgttgccgcatcgcttggcgcacaggct
gcaacgatcgaggccgtcatcagccccaacgctatcgtcgtcaaggcagacgggcaggca
cgcgtccatatgctggatggcaagccggtcctgtactgcggccttgacgcgttccttggc
tggtccgcgcggcttctcggcgcgcagatcgagccgggtgccgacgacggacctgtcgtg
acgttggctggcaaggcgacgcccattgcccgactgttcacgcgagaaggctggctgcga
ccggccgtgctaaacgatgcggcgcaagaagccctggccgagcgacgcggcggctgggcg
tgcgcgccgaagaccgagccgtttgcccagatgggcgttcgcgtcgatcccaagatcaca
gccggcatcgccatgaacgagtcgtcgtatcgcggccgtccgtggccctggacgcttaac
gtgtcgggtcgcggcatgttcttcgccacgcgcgaggaagcgtacgcggccgtcaatcgt
ctgctcgcgaatgaccgttgcgacttcgatgtgggcttgatgcaggtgaattggtgctac
cacggcaagcgttttgcgtcgccgtgggaggcgcttgccccagcgaccaacatccgcgtt
gccgaagacattctggcagagaaccttcagcgcagcggttcggccatgaaggctgtcgcc
tggtaccacagcgccaatcccgagcgcggtgggccgtacttttcccgcttcatgaaacac
gtcgcccaattccaatga

DBGET integrated database retrieval system