KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_0852Help
Entry
Rhom172_0852      CDS       T01606                                 

Definition
(GenBank) Nitrous-oxide reductase
  KO
K00376  nitrous-oxide reductase [EC:1.7.2.4]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
rmg00910  Nitrogen metabolism
rmg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rmg00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Rhom172_0852
Enzymes [BR:rmg01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     Rhom172_0852
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: COX2 Cupredoxin_1
Motif
Other DBs
NCBI-ProteinID: AEN72785
UniProt: G2SK29
Position
complement(972164..974152)
Genome map
AA seq 662 aa AA seqDB search
MKRHTLRGLTGLALAALLIGLIGCRGGGQTGAVVSEDPVEIARARGLSPADVVAAVKTYQ
PTGTYDEYIMFASGGHSGQVLVIGIPSMRLLKVIGVFTPEPWQGWGFSKETREVLAQGNY
DGKELTWGDVHHPALSETNGDYDGQFLFVNEKANARVAVIDLRDFETKQIVKNPLSLSDH
GGTFVTPNTEWVIEGGQYAAPFEGYASLDQYKEKYRGLVTFWKFDRERGRILPEQSFALE
LPPYWQDLCDAGKQVSEGWVFCNSFNTEMATGGVEKGNPPFEAGASQRDMDYLHVINLRK
AAELVEAGRTRTIKGFKVLPLDVAAAEGVLYFIPEPKSPHGVDVSPDGNYLVVSGKLDPH
ATIYNFQKIQDAIANERFSGRDDYGVPILDFDAVVEAQVELGLGPLHTQFDPNGYAYTSL
FLESAVVRWTLGGPWAEKHGRDPWTVVDKVSVHYNIGHLAVAEGDNVNPDGRYLVAMNKW
SVDRFANVGPLLPQNFQLIDIGNPNGPMQLLYDMPIALGEPHYAQIIKADKLHPWEVYPE
VGWDPTTQSRHPAATRPGEERIERRGNTVEIWMTATRSHFTPEHVEVRKGDRVIWHITNI
ERARDATHGFALPGYNFNLSIEPGETATIEFVADRDGVFAFYCTEFCSALHLEMAGYFLV
RP
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgccacacgttacgcgggctgaccggtctggcgctggccgccctgctgatcggc
ttgatcggttgtcggggcggcggacagacaggcgccgtggtcagcgaagaccccgtggag
atcgcgcgggcgcgtggactgagcccggccgatgtggtggccgcggtaaagacctaccag
cccaccggcacctacgacgagtacatcatgttcgcctcgggcgggcactccggacaggtg
ctcgtcatcggcattccctcgatgcgcctgctgaaggtgatcggcgtcttcacgccggag
ccctggcagggctggggcttctcgaaggaaacccgggaagtcctcgcccagggcaactat
gatggcaaggagttgacctggggtgacgtgcaccacccggccctctccgagacgaacggc
gactacgacgggcaattcctgttcgtcaacgaaaaggccaacgcgcgcgtggccgtcatc
gacctgcgggacttcgagacgaagcagatcgtcaagaacccgctctcgctgagcgaccac
ggcggcacgttcgtcacgcccaacacggagtgggtgatcgaaggcggccagtatgccgcc
ccgttcgagggctacgcctcgctggatcagtataaagagaagtatcgcgggctggtcacc
ttctggaagttcgaccgcgagcgggggcggatccttcccgagcagtccttcgcgctggag
ctgccgccctactggcaggacctgtgcgacgccggcaagcaggtgagcgaagggtgggtc
ttctgcaactcgttcaacacggaaatggccacgggtggcgtggagaaaggcaacccgccc
ttcgaggccggcgcctcgcagcgcgacatggactacctgcacgtgatcaacctgcgcaag
gcggctgagctggtcgaggccggtcgcacgcgcacgatcaagggcttcaaggtcctgccg
ctggacgtggccgccgccgaaggcgtgctctacttcatccccgaacccaagagcccgcac
ggcgtcgacgtttcgccggacggcaactacctggtcgtctccggcaagctcgatccgcac
gccaccatctacaacttccagaagatccaggacgccatcgccaacgagcgcttctcgggg
cgtgacgactacggtgtgccgatcctggacttcgacgcggtggtcgaagcgcaggtagag
ctggggctcggaccgctgcacacgcagttcgacccgaacggctacgcctacacgagcctt
ttcctggaaagcgccgtggtgcgctggacgctgggcggtccctgggccgaaaagcacggc
cgggatccatggaccgtggtcgacaaggtgtcggtccactacaacatcgggcacctggcc
gtggccgaaggcgacaacgtgaaccccgacggccgctacctggtggccatgaacaagtgg
tccgtggaccgtttcgcgaacgtggggccgctgttgccgcagaactttcagctcatcgac
atcggcaacccgaacggcccgatgcagctcctctacgacatgcccattgcactgggtgag
ccgcactatgcccagatcatcaaggcggacaagctccacccgtgggaggtctatccggaa
gtcggctgggatccgaccacccagtcgcggcatccggcggccacccgtcccggggaggag
cgcatcgagcgccggggcaacacggtggagatctggatgacggccacacgcagccacttc
acgccggagcatgtggaggtccggaagggcgaccgcgtgatctggcacattacgaacatc
gaacgggcgcgggacgccacgcacggcttcgcgctgcccggctacaacttcaacctgagc
atcgagccgggcgagacagccaccatcgagttcgtggccgatcgcgacggcgtcttcgcc
ttctactgcaccgagttctgctcggccctccacctggagatggccggttacttcctagtg
cgtccgtaa

DBGET integrated database retrieval system