KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_0987Help
Entry
Rhom172_0987      CDS       T01606                                 

Definition
(GenBank) protein of unknown function DUF88
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NYN Hemerythrin GPP34 DUF3662
Motif
Other DBs
NCBI-ProteinID: AEN72917
UniProt: G2SG17
Position
complement(1116403..1117377)
Genome map
AA seq 324 aa AA seqDB search
MQGIMDRSHSRKPIRTTALFVDYENLYQQAARYLKHTDNLNGQLADLLYSLRRYLLARRR
FRVVLGRAYADFEQYDDGLAIQRVLAEQGIVPRMVPNSYDAPSRSLQLTIDALQTLQSHP
EVQAFVVVSGNRSYLPLLEHLRGHGRQIALLQLTSPSDLVYERLGDRLLLDPRPILEHAG
LRQLLAHLSGPVADTPPAPPPAFASLADDPDALKALELILEHFGQYEEVYLTPLLRKMSE
TFDETRVEPKELINRLEAAGAVRLERRRGFPYDYTVLILHEDHPDVRRLRETLASRPEPE
PEASGDLSEEDHVEDTSGEEPSAF
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgcagggaataatggatcgttcgcattccagaaaaccgattcgtaccacggccctcttt
gtggattacgagaacctgtatcagcaggctgcccgctacctgaaacataccgacaacctc
aacggacagctggccgatctgctctacagcctccgtcgctatctgctggcgcgtcgtcgc
ttccgcgtggtgttgggccgcgcctatgccgacttcgagcaatacgacgacggtctggcc
atccagcgcgtgctggccgaacagggcattgtcccgcggatggttccgaacagctacgac
gcgccgtcccggtcgcttcaactcaccatcgacgccctgcagacgctgcagagccatccc
gaagtgcaggcgttcgtggtggtcagcggcaaccgctcgtacctgccgctgctggagcac
ctgcgcggccacggccgccagatcgctctcctgcagctgacctcgccttccgacctggtc
tatgagcgcctgggcgaccgtctgctgctggatccccgcccgattctggagcacgccggc
ctgcgccagttgctggcgcatctctcgggccccgtggcggataccccgcctgctccgccg
ccggccttcgcctcgctggccgacgatccggacgccctgaaggcgctcgaactgatcctc
gaacacttcggccagtacgaggaggtctacctcacgcccctgctccggaagatgtccgaa
accttcgacgagacccgggtcgagccgaaagagctgatcaaccgcctcgaagcggccggt
gccgtccgcctggagcgccgtcgcggtttcccctatgattacaccgtactcatcctgcac
gaagaccatcccgacgtacgtcgccttcgcgaaacgctggcctcacggcccgagccggaa
cccgaagccagtggagatctatccgaagaagatcacgttgaagacacttccggggaagaa
ccgtcggcgttctaa

DBGET integrated database retrieval system