KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_0991Help
Entry
Rhom172_0991      CDS       T01606                                 

Definition
(GenBank) cell shape determining protein, MreB/Mrl family
  KO
K03569  rod shape-determining protein MreB and related proteins
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Brite
KEGG Orthology (KO) [BR:rmg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rmg03036]
    Rhom172_0991
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rmg04812]
    Rhom172_0991
   02048 Prokaryotic Defense System [BR:rmg02048]
    Rhom172_0991
Chromosome and associated proteins [BR:rmg03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    Rhom172_0991
Cytoskeleton proteins [BR:rmg04812]
 Prokaryotic cytoskeleton proteins
  Actin homologs
   Actins
    Rhom172_0991
Prokaryotic defense system [BR:rmg02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    Rhom172_0991
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MreB_Mbl HSP70 Actin FtsA PilM_2 Ppx-GppA EutA
Motif
Other DBs
NCBI-ProteinID: AEN72921
UniProt: G2SG21
Position
complement(1120352..1121362)
Genome map
AA seq 336 aa AA seqDB search
MGLFNFATDVAIDLGTANTLVYIKGRGIVLNEPSIVAVHRSTRKVIAIGREALQMHERTH
PEIETIRPLQDGVIADFEVAEQMIRGFIQKVQRSWYTSIRRMVVCIPSGITEVEKRAVRD
SAEHAGAKRVYLISEPMAAAIGIGLNVEEPVGNMVVDIGGGTTEIAVIALAGIVVNESIR
IGGDELDNAIIQYFKRNHNLLIGQRTAERIKCEIGSAVELDPELELSVKGRDLVSGIPKI
RTISSEDVREALREPVSQIAAAVLRCLERTPPELGADILERGIMLTGGGALLKGLDVLIR
NRVELPVYVAEDPLTAVARGTGKVLEDIDRYERVLL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggggctgttcaacttcgccaccgacgttgccattgacctggggacggccaacaccctg
gtttacatcaagggccgcggcatcgtgctgaacgaacccagcattgtggccgtgcaccgg
agcacgcgtaaggtcattgctatcggccgcgaagccctgcagatgcacgagcgcacgcac
cccgagatcgaaacgatccggccgctccaagacggcgtcatcgccgacttcgaggtggcc
gagcagatgatccggggtttcattcagaaggtgcagcggagctggtacacctcgatccgc
cgcatggtggtctgcattcccagcggcatcaccgaggtggaaaagcgcgccgtgcgcgac
tcggccgagcacgccggtgccaagcgcgtctatctgatcagcgaacccatggccgccgcc
atcggcatcggcctgaacgtggaggagccggtgggtaacatggtggtagacatcggcggc
ggcaccaccgagatcgccgtgatcgcgttggccgggattgtcgtgaacgagtcgatccgt
atcggcggcgacgaactggacaacgcgatcatccagtacttcaagcgcaatcataacctg
ctgatcggccagcgcacggccgagcgcatcaagtgcgagatcggaagtgccgtcgagctg
gacccggagctggaactgtcggtcaaagggcgcgacctggtcagcggcattcccaagatt
cgaaccatctcgtcggaagacgtgcgcgaggcgttgcgcgagccggtcagtcagatcgcg
gcggccgtgctgcgctgcctggagcgcaccccgccggagctgggcgccgacattctggag
cgcggcatcatgctgacgggcggcggcgccctgctcaaagggctggatgtgctgatccgc
aaccgcgtggagctgccggtctacgtggccgaggatccgctgacggccgtggcccgcgga
accggcaaggtgctggaagacatcgatcgctacgagcgggtgctgctctga

DBGET integrated database retrieval system