KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_1000Help
Entry
Rhom172_1000      CDS       T01606                                 

Definition
(GenBank) transposase
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DDE_3 HTH_23 HTH_32 HTH_33 HTH_28 HTH_29 DDE_1 LZ_Tnp_IS481 Crp HTH_Tnp_ISL3
Motif
Other DBs
NCBI-ProteinID: AEN72930
UniProt: G2SG30
Position
complement(join(1129505..1130095,1130095..1130553))
Genome map
AA seq 349 aa AA seqDB search
MPRAPLPPITETLEELRQRLQAERHAERKRRLHMLLLFKEDPTRTREAVAQHLAASRNTI
GRWLRRYARGGLEARLSIERRGPKPGQRTVPRPVYVAIQKRLRQPEGFAGYKQLQQWIYE
AFGLEVPYKSVYNLVRYHLGAKLKVPRPVHPKKSLAEAAAFAARLGRRLQSIAAFAAERR
PVRLFFADEARIGLHLPRYRRLTARGVAPRYRFYWLYAAVEPRSGETFYLEMPSLDAECF
SVFLREFGRCYGESLNVLVLDNAAAHRARSVEVPENVVLLFLPAYSPELSPVERLWRAVR
ARLDVFDARVRSQLEALRAHVAEIVRGLRAVEVARLTRYDYIKVALNAL
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgcgctccccttcctcccatcaccgaaacgctcgaagagctccgccaacgcctc
caggccgaacgccacgccgaacgcaaacgccgcctgcacatgctgctgctctttaaagaa
gaccccacccgcacccgggaggccgtagcccagcatctggccgcaagtcgcaacacgatt
ggccgctggctgcgtcgctatgcccgaggcggtcttgaggcgcggctttcgatcgagcgg
cgcgggcccaagcccggtcagcgtaccgtgccccggcccgtctatgtagccatccagaag
cggctgcgccagccggagggctttgccggctacaagcagctccagcaatggatctatgag
gcctttgggctcgaggtgccctacaagagcgtctacaacctggtacgctaccacctgggg
gccaagctgaaagtcccccggccggtgcacccaaaaaaaagcctagccgaagcggcggca
tttgcggcgcgccttggacgtcgcctgcagagcatagcggcctttgcagccgagcgacgg
ccggttcgtttgtttttcgcggatgaggcgcgcattgggcttcatttgccgcgctatcgt
cggctgacggctcggggtgtggcgccgcgctaccgtttctactggctgtatgcggcggta
gagccccggagtggagagacgttttatctggagatgccctcgttggatgcggaatgtttt
tcggtgtttttgcgggagtttggccgttgctacggtgagagtctcaacgtgttggtgctc
gacaatgcggcggcgcaccgggcgcgttcggtggaggtcccggagaacgtagtgttgttg
tttttgccggcgtatagtccggaactgagtccggtggagcggttgtggcgggcggttcgg
gcgcgccttgatgtctttgacgcgcgggttcggagtcagttggaggcgttgcgggcgcac
gtggcggagattgtgcggggattgagggcggtagaggtggctcggctgacgcgttacgac
tacatcaaagtcgctctcaatgcactataa

DBGET integrated database retrieval system