KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_1042Help
Entry
Rhom172_1042      CDS       T01606                                 

Definition
(GenBank) S-adenosylmethionine:tRNA ribosyltransferase-isomerase
  KO
K07568  S-adenosylmethionine:tRNA ribosyltransferase-isomerase [EC:2.4.99.17]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Brite
KEGG Orthology (KO) [BR:rmg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rmg03016]
    Rhom172_1042
Enzymes [BR:rmg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.17  S-adenosylmethionine:tRNA ribosyltransferase-isomerase
     Rhom172_1042
Transfer RNA biogenesis [BR:rmg03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    Rhom172_1042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Queuosine_synth
Motif
Other DBs
NCBI-ProteinID: AEN72972
UniProt: G2SHG2
Position
1199541..1200587
Genome map
AA seq 348 aa AA seqDB search
MRLSDLHYDYPKSLVAKYPAEPRDSARLMVLDRKRRSIEHRIFRDIVDYFNEGDVLVVNN
TKVFPARLYGRKEKTGARIEVLLLRELNAESRLWDALVDPARKIRVGNKIYFDGGLVAEV
IDNTTSRGRTIRFLFDGSDEELYQKIEEVGHMPLPPYIKREDEPEDRERYQTIFAQETGS
VAAPTAGLHFTPELVERLKQKGVDVVPITLHVGLGTFRPIEVEDLTKHRMDSEYFTITEE
AAERINRALLSPEHTVTAVGTTVVRALESSISATGTVKPGFGWTDKFIYPPYDFKIVERL
ITNFHMPRSTLLALVVAFAGYDFVMEAYRTAVQEKYRLFSFGDAMLIL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgcggttgtctgatctgcactacgattatcctaaaagcctggtcgccaagtatccggcc
gagccgcgcgacagcgcccgactgatggtgctcgaccgcaagcgcaggagcatcgaacat
cgcatcttccgcgacattgtcgattatttcaacgaaggcgatgttctggtggtcaataat
acgaaagtttttccggcgcggctctacggccgcaaggaaaaaaccggagccagaatcgaa
gtcctgctgctgcgcgagctgaacgccgaaagccgtctctgggacgcgcttgtcgatccg
gcccgcaagatccgggtgggcaacaagatctacttcgacggcgggctggtggccgaggtg
atcgacaacacgacgtcgcgcggccgtacgatccggttcctcttcgacggcagcgatgaa
gaactctatcagaaaatcgaagaagtcggccacatgccgctgccgccctacatcaagcgc
gaagacgagccggaggatcgcgagcgctatcagacgatctttgcgcaggagacgggttcg
gtggcggctccgacggccggtttgcactttacgccggagctggtcgagcgcctgaagcag
aaaggcgtcgacgtcgtgcccatcacgttgcacgtgggactgggcaccttccggccgatc
gaggtcgaggacctcaccaagcatcgcatggattctgagtactttaccatcaccgaggag
gcggccgagcgcatcaatcgcgccctgctttccccggagcacaccgtgacggccgtgggg
acgacggtggtgcgggcgctcgagtcgagcatctcggccaccggcacggtcaagcccggt
tttggctggacggacaagttcatctatccgccttacgacttcaagatcgtcgagcggctc
attaccaacttccacatgccgcgcagcacgctgctggcgctggtggtggcgtttgccggg
tacgacttcgtcatggaggcctaccgcaccgccgttcaggaaaaataccggctgttttcc
ttcggggatgccatgctgattctctga

DBGET integrated database retrieval system