KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_1047Help
Entry
Rhom172_1047      CDS       T01606                                 

Definition
(GenBank) preprotein translocase, SecE subunit
  KO
K03073  preprotein translocase subunit SecE
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
rmg02024  Quorum sensing
rmg03060  Protein export
rmg03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:rmg00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    Rhom172_1047
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Rhom172_1047
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Rhom172_1047
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rmg02044]
    Rhom172_1047
Secretion system [BR:rmg02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components [MD:M00335]
   Rhom172_1047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SecE Stork_head
Motif
Other DBs
NCBI-ProteinID: AEN72977
UniProt: G2SHG7
Position
1204436..1204624
Genome map
AA seq 62 aa AA seqDB search
MFAKVRDYLQEVYREMQKVSWPSRQELINNTILTLVASTVLALFIFLADRVIATVLEFIY
SL
NT seq 189 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcaaaagtccgggattatctccaggaagtttaccgcgaaatgcagaaggtgagc
tggccctcgcgtcaggagctgatcaacaacaccattctgacgctggtggcctcgaccgtg
ctggcgctgttcatcttcctggccgatcgggtgattgccacggtgctggaattcatctac
tccctgtaa

DBGET integrated database retrieval system