KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_1050Help
Entry
Rhom172_1050      CDS       T01606                                 

Definition
(GenBank) ribosomal protein L1
  KO
K02863  large subunit ribosomal protein L1
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
rmg03010  Ribosome
Module
rmg_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:rmg00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Rhom172_1050
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rmg03011]
    Rhom172_1050
Ribosome [BR:rmg03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    Rhom172_1050
  Bacteria
    Rhom172_1050
  Archaea
    Rhom172_1050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L1 DUF982
Motif
Other DBs
NCBI-ProteinID: AEN72980
UniProt: G2SHH0
Position
1205837..1206547
Genome map
AA seq 236 aa AA seqDB search
MPKKRGKRYRQALEIIQQAGDGPFALEEAAELVKKTALAKFDESVDIDVRLGVDPRHADQ
MVRGTVALPHGTGKKVRVLVLADEGRWKEALEAGADYAGLDEYIDQIQNGWLEFDVVIAT
PQVMSKISRLGRILGPRGLMPNPKSGTVTENVAEAVREVKAGRIDFRVDKTGNLHTAIGK
ASFTSQQIRENAEAFLREVLRLRPPSVKGAYVRSITLSTTMGPPVPVSLSVLNTLR
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagaaacgaggaaaacgctatcgccaggcgcttgagatcattcagcaggccggc
gacggtcccttcgcgctggaggaggcggccgagctggtcaagaagacggcgctggccaag
tttgacgaatcggtcgatatcgacgtgcggctgggcgtcgacccccgccacgccgatcag
atggtgcgcggcaccgtagccctgccacacggcacgggtaaaaaggtgcgagtgctggtg
ctggccgacgaaggtcgctggaaggaagccctggaggcgggcgccgattacgccggtctg
gacgagtatatcgaccagatccagaacggctggttggagttcgacgtggtcattgccacg
ccgcaggtgatgagcaagatcagtcggctgggccgcattctcggaccccgcgggctcatg
cccaatcccaagagcgggacggtgaccgaaaatgtggccgaggctgtgcgcgaggtcaag
gccggccgcatcgactttcgcgtggataagaccggcaacctgcacaccgccatcggcaag
gcttcgtttacgagccagcagatccgcgagaacgccgaggctttcctgcgcgaggtgctc
cggctgcgtccgccttccgtaaagggagcctatgtgcgttccatcacgctttcgacgacg
atggggccgccggtgccggtgagcctgagcgtgctcaacacgctccgatga

DBGET integrated database retrieval system