KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_1052Help
Entry
Rhom172_1052      CDS       T01606                                 

Definition
(GenBank) ribosomal protein L7/L12
  KO
K02935  large subunit ribosomal protein L7/L12
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
rmg03010  Ribosome
Module
rmg_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:rmg00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Rhom172_1052
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rmg03011]
    Rhom172_1052
Ribosome [BR:rmg03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    Rhom172_1052
  Bacteria
    Rhom172_1052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L12 Ribosomal_L12_N
Motif
Other DBs
NCBI-ProteinID: AEN72982
UniProt: G2SHH2
Position
1207216..1207596
Genome map
AA seq 126 aa AA seqDB search
MADLKALAEQLVNLTIKEANELAKILEEEYGIKPAAAAVAVAAGPAGGDGAAAAEEKTEF
DVILKAAGGNKIAVIKEVRAITGLGLKEAKELVDSAPKPIKEGVSKEEAEQIKAKLEEAG
AEVEIK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggcagacctgaaagcactcgccgaacagctggtcaacctgacgatcaaggaggcgaac
gaactcgccaagatcctggaggaagagtacggcatcaagccggcggctgcggccgtggcc
gtcgcggccggtccggccggtggtgacggggccgccgcggccgaggagaagaccgagttt
gacgtgatcctcaaggcggccggcggcaacaagatcgccgtcatcaaggaagtacgcgcc
atcacggggctcggtctcaaagaggccaaagaactggtcgacagcgcccccaagccgatc
aaggagggcgtcagcaaggaagaggccgagcagatcaaggccaagctggaggaggccggc
gccgaggtggaaatcaagtaa

DBGET integrated database retrieval system