KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_1092Help
Entry
Rhom172_1092      CDS       T01606                                 

Definition
(GenBank) Succinyl-CoA ligase (ADP-forming) subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
rmg00020  Citrate cycle (TCA cycle)
rmg00640  Propanoate metabolism
rmg00660  C5-Branched dibasic acid metabolism
rmg01100  Metabolic pathways
rmg01110  Biosynthesis of secondary metabolites
rmg01120  Microbial metabolism in diverse environments
rmg01130  Biosynthesis of antibiotics
rmg01200  Carbon metabolism
Module
rmg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rmg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rmg00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rhom172_1092
   00640 Propanoate metabolism
    Rhom172_1092
   00660 C5-Branched dibasic acid metabolism
    Rhom172_1092
Enzymes [BR:rmg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Rhom172_1092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 Succ_CoA_lig DUF2188 GARS_A
Motif
Other DBs
NCBI-ProteinID: AEN73021
UniProt: G2SHL1
Position
1265341..1266528
Genome map
AA seq 395 aa AA seqDB search
MKLHEYQAKDILQRYGVATQPGYVARTVEEAVEAARRLQQEQGYELFVVKAQIHAGGRGK
GGGVKLAKGIEEVREKAGAILGMNLVTPQTGPEGQKVRAVLVAGAVDIAKEYYLGITLDR
QRSQNVIMASTEGGVEIEEVAARSPEKILKVWVDPTIGLRPFQARQLAFGLGFEGNAFKQ
AVQFIQALYRAYEETDSSLAEINPLVLTKQGDVVAVDAKINLDDNALFRHPDLAELRDIH
EEDPLEVEASKYRLNYVRLTGNVGCMVNGAGLAMATMDLIKLAGGEPANFLDVGGGASPE
TVEAGFRIILKDPNVKVILVNIFGGIVRCDRVARGIVEAARKVQINVPLIVRLQGTNAEE
ARAILEQSGLEIETATLFKEVADKVNQALQRVAAA
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgcacgagtatcaggccaaggatattctgcaacgctatggcgtggccacgcag
cccggttatgtggcccgcaccgtggaggaagcggtcgaagccgcccgtcgcctgcagcag
gagcaggggtatgagctgttcgtggtgaaggcgcagattcacgccggcggtcgcggcaag
ggcgggggcgtcaagctggcgaagggtatcgaggaggtgcgcgagaaggccggcgccatt
ctgggcatgaacctggtcacgccccagacgggccctgagggacagaaagtgcgggccgtg
ctggtggccggtgccgtcgatattgcaaaggaatactatctgggcatcacgctggaccgc
cagcggagccagaacgtgatcatggcctcgacggaagggggcgtggagatcgaggaagtg
gccgcccggagccccgagaagatcctgaaggtgtgggtcgatcccacgatcggcctgcgt
ccgttccaggcacgccagctggccttcgggctgggcttcgagggcaacgccttcaaacag
gccgtccagttcatccaggcgctctatcgggcttacgaagaaaccgacagctcgctggcc
gagatcaacccgctcgtgctgacgaagcagggcgacgtggtggccgtcgatgccaagatc
aacctggacgacaacgcgcttttccggcatcccgatctggccgagctccgcgacatccac
gaagaagacccgctggaggtcgaggccagcaagtaccggctcaactacgtgcggctcacc
ggcaacgtaggctgcatggtgaacggagccggcctggccatggccacgatggacctgatc
aagctggcgggcggcgagccggccaacttcctggacgtgggcggtggggccagcccggag
accgtggaggccggcttccgcatcatcctgaaggacccgaacgtcaaggtgattctggtg
aatatcttcggcggcatcgtgcgctgcgaccgcgtcgcccgcggcatcgtcgaggcggcc
cgaaaggttcagatcaacgtgccgctgatcgtgcggctgcagggcaccaatgctgaagaa
gcgcgtgccattctggagcagagcggcctggaaatcgagacggccacgctcttcaaagag
gtggccgacaaggtgaaccaggcgctgcagcgcgtcgccgcagcctga

DBGET integrated database retrieval system