KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_1264
Entry
Rhom172_1264      CDS       T01606                                 

Definition
(GenBank) hypothetical protein
  KO
K18818  mannosylglycerate synthase [EC:2.4.1.269]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
rmg00051  Fructose and mannose metabolism
rmg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rmg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Rhom172_1264
Enzymes [BR:rmg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.269  mannosylglycerate synthase
     Rhom172_1264
SSDB
Other DBs
NCBI-ProteinID: AEN73191
UniProt: G2SKD8
Structure
PDB: 

Position
1450825..1452018
AA seq 397 aa
MSLVVFPFKHEHPEVLLHNVRVAAAHPRVHEVLCIGYEREQTYEAVERAAPEISRATGTP
VSVRLQERLGTLRPGKGDGMNTALRYFLEETRWERIHFYDADITSFGPDWITKAEEAADF
GYGLVRHYFPRASTDAMITWMITRTGFALLWPHTELSWIEQPLGGELLMRREVAAMLYED
ERVRRRSDWGIDTLYTFVTVQQGVSIYECYIPEGKAHRLYGGLDDLRTMLVECFAVIQSL
QHEVVGQPAIHRQEHPHRVPVHIAERVGYDVEATLHRLMQHWTPRQVELLELFTTPVREG
LRTCQRRPAFNFMDEMAWAATYHVLLEHFQPGDPDWEELLFKLWTTRVLNYTMTVALRGY
DYAQQYLYRMLGRYRYQAALENGRGHPVPPRAALSTA
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgagcctggtcgtttttcccttcaagcacgaacaccccgaggtgctgctgcacaacgtg
cgcgtggcggctgctcatccccgggtgcacgaggtgctctgcatcggatacgagcgcgaa
cagacctacgaggccgtcgaacgggccgcgcccgagatctcgcgggccacagggacgccg
gtgtcggtccggttgcaggagcgactgggcacgctgcggcccggcaagggcgacggcatg
aacaccgcgctccgatacttcttggaagaaacccggtgggagcgcatccacttctacgat
gccgacatcaccagcttcgggccggactggatcaccaaggccgaagaggcggccgatttc
ggctacgggctggtgcggcactacttcccgcgggcctcgaccgacgcaatgatcacctgg
atgatcacgcgcacgggcttcgccctgctctggccgcataccgaactgtcgtggatcgag
cagccgctgggcggcgagctgctcatgcggcgcgaagtggccgccatgctttacgaggac
gaacgggtgcgacggcggagcgactggggcatcgacacactctacacgttcgttaccgtg
cagcagggcgtttcgatctacgagtgctacattcctgagggcaaggcgcatcgcctctac
ggcgggctcgacgacctgcgcaccatgctggtcgagtgttttgccgtcatccagagtctg
caacatgaggtcgttggccagccggccattcatcgccaggagcacccgcaccgcgtgccg
gtccacattgccgaacgcgtgggctacgacgtggaggccacgctgcatcgcctcatgcag
cactggacgccccggcaggtggagctgctggagctttttaccacacccgtgcgcgaagga
ctgcgcacctgtcagcgtcgcccggctttcaacttcatggacgagatggcctgggcggcc
acctatcacgtgctgctcgagcactttcagccgggcgatccggactgggaggagctgctc
ttcaaactctggacgacccgcgtgctcaactacacgatgacggtcgcgctgcggggctac
gactacgcgcagcagtatctctaccggatgctgggacgctaccgctatcaggccgctctg
gaaaacggccgtggtcatccggtcccgccgcgggcggcactgtcgaccgcctga

DBGET integrated database retrieval system