KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_1487Help
Entry
Rhom172_1487      CDS       T01606                                 

Definition
(GenBank) Acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
rmg00010  Glycolysis / Gluconeogenesis
rmg00620  Pyruvate metabolism
rmg00640  Propanoate metabolism
rmg00680  Methane metabolism
rmg01100  Metabolic pathways
rmg01110  Biosynthesis of secondary metabolites
rmg01120  Microbial metabolism in diverse environments
rmg01130  Biosynthesis of antibiotics
rmg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rmg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rhom172_1487
   00620 Pyruvate metabolism
    Rhom172_1487
   00640 Propanoate metabolism
    Rhom172_1487
  Energy metabolism
   00680 Methane metabolism
    Rhom172_1487
Enzymes [BR:rmg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Rhom172_1487
Lipid biosynthesis proteins [BR:rmg01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Rhom172_1487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AEN73409
UniProt: G2SHU3
Position
1694033..1696024
Genome map
AA seq 663 aa AA seqDB search
MQTGSAFSLTTGTFPFNQPVVWEPRPEWIAASNLQRFMNRHGIGSLDELQARSVDNPEWF
WPAVLEDLDIRFYRPYTRILDLSEGPAFPRWCVGGQLNIVHNLLDKWQETNAAERIALRW
EGEEGTLRTLTYAGLHAEVCRCARALQSLGFQKGDVAALFMPMTPELVIAFLAVIKLGGI
VLPLFSGYGAEAVRTRIRDAEARFLFTADGFYRRGRPVYLKPVADEALADCPSVQHVIVY
RRMEADNVPVPMLPGRDHWWHELVWPQPAEAETVRTDAEDVLMVIYTSGTTGRPKGAVHT
HCGFPVKAAQDMYQCMDLKPGETMYWVTDMGWMMGPWLVFGTLLIGATMVLYDGAPDYPD
VDRLWGLVEQHRVTHLGISPTLIRALRPHGPEPIRRHDLSSLRAVGSTGSPWDPESWLWC
FEHVLGREKPILNYSGGTEISGGILCGNFFRPLKPCAFSGPVPGMAADVVDEQGRPVREA
VGELVIRKPWIGMTRGFWRDRERYLDTYWRRIEGLWVHGDFAAIDRDGLWYILGRSDDTI
KVAGKRLGPAEVEAILNAHEAVAESAAIGVPHEVKGEEVVAFVVLKPGVSPSEELRQELM
ERVVAALGKPLKPREIRFTTALPKTRNAKIMRRVIRAAYLGQDPGDVSSLEDPAAVEAIR
QAV
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccggaagcgcttttagtttgaccaccggcacctttcccttcaaccagcccgtg
gtctgggagccgcggccggagtggatcgcggccagcaacctgcagcggttcatgaaccgc
cacggcatcggttcgctcgacgagctgcaagcccgctcggtcgacaacccggagtggttc
tggccggccgtgctggaagatctggacattcgcttctaccgaccttacacgcgcattctg
gatctgagcgaaggaccggccttcccgcgctggtgcgtgggtggccagctcaacatcgtc
cacaacctgctggacaaatggcaggagacgaacgcggccgaacgtatcgcgctgcgctgg
gaaggcgaagaaggtacgctgcgcacgctgacctacgcgggcctgcacgccgaggtgtgc
cgctgcgcccgcgccctgcagtcgctgggcttccagaaaggcgacgtggccgcgctcttc
atgccgatgacgcccgagctggtcatcgccttcctggccgtgatcaagctgggcgggatc
gtgctgccgctcttcagcggctacggcgccgaggccgtccgcacccgcatccgggacgcc
gaagcacgctttctgttcacggccgacggtttctaccggcgcggccgcccggtctacctg
aagcccgtggccgacgaagcgctggccgactgcccgagcgtgcagcacgtgatcgtctac
cgccgcatggaggccgacaacgtaccggtgcccatgctcccgggccgcgaccactggtgg
cacgagctggtctggccgcaaccggccgaggccgagacggtccgcaccgacgccgaagac
gtgctcatggtcatctacacgagcggcaccacgggccgcccgaaaggggccgtccacacg
cactgcggctttccggtcaaggccgcccaggacatgtaccagtgcatggacctcaagccg
ggcgaaaccatgtactgggtgaccgacatgggctggatgatgggcccctggctggttttc
ggcacgctgctcatcggggccacgatggtgctctacgacggcgcgcccgactacccggac
gtcgatcggctctggggactggtcgaacagcaccgggtaacgcatctgggcatctcgccc
acgctgatccgggcgctgcggccgcatggtccggagcccattcgccgccacgatctgtcg
agcctccgggcggtgggttcgaccggtagtccctgggacccggaatcctggctctggtgc
ttcgagcacgtgctcggccgcgaaaagcccattctcaactactcgggcggcacggagatc
tccggcgggattctctgcggcaactttttccgtccgctcaaaccctgcgcgttctcgggt
ccggtacccggtatggccgccgacgtggtggacgagcagggacgccccgtgcgcgaggcc
gtcggcgagctggtcatccgcaagccctggatcggcatgacgcgcggcttctggcgcgac
cgcgaacgctaccttgacacctactggcgccgcatcgaaggactctgggtacacggcgat
tttgccgccatcgaccgcgacggcctctggtacatcctgggccgctcggacgacacgatc
aaggtggccggcaagcgcctgggtccggccgaagtcgaggccatcctgaacgcccacgaa
gccgtggccgaaagtgcggcgatcggcgtcccgcacgaggtcaaaggcgaagaagtggta
gccttcgtcgtcctgaagcccggcgtttcaccctccgaagaactccgccaggaactcatg
gagcgcgtggtagcggcactgggcaaacccctgaagccccgcgagatccggttcaccacg
gccctgcccaagacgcgcaacgccaagatcatgcgccgtgtgatccgggccgcgtatctc
ggtcaggatccgggcgacgtgagcagcctcgaagatccggccgccgtcgaggccatccgc
caggccgtctga

DBGET integrated database retrieval system