KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_2601Help
Entry
Rhom172_2601      CDS       T01606                                 

Definition
(GenBank) Pyruvate synthase
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
rmg00010  Glycolysis / Gluconeogenesis
rmg00020  Citrate cycle (TCA cycle)
rmg00620  Pyruvate metabolism
rmg00640  Propanoate metabolism
rmg00650  Butanoate metabolism
rmg00680  Methane metabolism
rmg01100  Metabolic pathways
rmg01120  Microbial metabolism in diverse environments
rmg01130  Biosynthesis of antibiotics
rmg01200  Carbon metabolism
Module
rmg_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rmg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rhom172_2601
   00020 Citrate cycle (TCA cycle)
    Rhom172_2601
   00620 Pyruvate metabolism
    Rhom172_2601
   00640 Propanoate metabolism
    Rhom172_2601
   00650 Butanoate metabolism
    Rhom172_2601
  Energy metabolism
   00680 Methane metabolism
    Rhom172_2601
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Rhom172_2601
Enzymes [BR:rmg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Rhom172_2601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C DUF2065
Motif
Other DBs
NCBI-ProteinID: AEN74489
UniProt: G2SJU8
Position
2976583..2977590
Genome map
AA seq 335 aa AA seqDB search
MMTGLSSNGEAIRLKTLKELAEREQRELRFQGGHSLCAGCGVPLVVRTVLNAIDTPVVVV
NATGCLEVATTRYPSTAWNVPWLHVAFENAAAAASGVEAAFRVLNRKCKNGRPIPFDLPE
DVRIIAFGGDGGTYDIGLQALSGALERGHRFTYICYDNEAYMNTGNQRSGATPPLAHTTT
TPVGEQSLGKLQQRKDLTEIAVAHHVPYVAQASISNWQDLVRKIQMAVQVDGPSFLNVLA
PCQRGWGYDPSQTVEIARLAVETCFWPLYEVIDGEYRLNYRPRKPLPIAEWVKTQGRFRH
LLRPEHRHLLDALQEQVNREWERLLRKCEGRLLEV
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccgggctttcctccaacggcgaagcgattcgcctgaagacgctcaaggaactg
gccgaacgcgagcagcgcgagctgcgcttccagggcggccactcgctctgtgcgggctgc
ggcgtgccgctggtggtgcgcaccgtgctgaacgccatcgacacgcccgtggtggtggtc
aacgcgacgggctgcctggaggtggccaccacgcgctatccttcgacggcctggaacgta
ccctggctgcacgtggccttcgagaacgcggccgccgccgccagcggcgtggaggccgcc
ttccgggtactcaaccgcaagtgcaaaaacggccggccaatccccttcgacctgcccgaa
gacgtgcgcatcatcgccttcggcggcgacgggggcacctacgacatcgggctgcaggcc
ctctcgggcgccctggagcgcgggcaccgcttcacctacatctgctacgacaacgaagcc
tacatgaacacgggcaaccagcggagtggcgccacgccgccgctggcccatacgaccacc
acgcccgtgggcgaacagagcctgggcaaactccagcagcgcaaggacctgacggagatc
gccgtcgcccaccacgtgccgtatgtggcccaggcgtcgatctcgaactggcaggatctg
gtgcgcaagatccagatggccgtgcaggtggacggaccgagctttctcaacgtactggcg
ccctgccagcgcggctggggctacgatccgtcccagaccgtcgagattgcccgcctggcc
gtcgaaacgtgcttctggccgctctacgaggtgatcgacggcgagtaccggctgaactac
cgaccgcgcaagccgctgcccatcgccgagtgggtcaaaacgcagggacgcttccgccac
ctgctccgcccggagcaccgacacctgctcgacgcgctacaggagcaggtcaaccgcgaa
tgggagcggctgctgcgcaaatgcgaaggacgcctgctggaagtgtag

DBGET integrated database retrieval system