KEGG   Rickettsia massiliae AZT80: RMB_02945Help
Entry
RMB_02945         CDS       T01758                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
rmi  Rickettsia massiliae AZT80
Pathway
rmi03010  Ribosome
Brite
KEGG Orthology (KO) [BR:rmi00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    RMB_02945 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rmi03011]
    RMB_02945 (rplV)
Ribosome [BR:rmi03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    RMB_02945 (rplV)
  Bacteria
    RMB_02945 (rplV)
  Archaea
    RMB_02945 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AFB31431
UniProt: H6QID1
Position
523708..524067
Genome map
AA seq 119 aa AA seqDB search
MVQENKNFATAQAKSVRVSSRKLNLVAAFIRNMKVSEALVQLTFSPKRIAKVVKDCLQSA
VANAENNLGLDIDRLVITKATVGKALVMKRVMPRAKGRATRINKFFSNLYITVTEKEDN
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atggtacaggaaaataaaaattttgctacggcacaagctaaatctgttagagtaagttca
aggaagctcaatttagttgcagcctttattagaaatatgaaagtatctgaagccttggta
caattaactttttctcctaaaagaattgcaaaagttgtaaaagattgtttacaatctgct
gttgcaaatgctgaaaataatttaggtctagatatagatagattggttattactaaagcg
actgtaggtaaggctttagtaatgaaaagagttatgccaagagcaaaaggaagagcaact
agaataaataagttttttagtaatctttatataactgttacagaaaaagaggataattaa

DBGET integrated database retrieval system