KEGG   Rickettsia massiliae AZT80: RMB_05070Help
Entry
RMB_05070         CDS       T01758                                 

Definition
(GenBank) PetR
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
rmi  Rickettsia massiliae AZT80
Pathway
rmi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rmi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RMB_05070
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:rmi02022]
    RMB_05070
Two-component system [BR:rmi02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   RMB_05070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C AbiEi_3 DUF2124
Motif
Other DBs
NCBI-ProteinID: AFB31777
UniProt: H6QJC7
Position
874670..875350
Genome map
AA seq 226 aa AA seqDB search
MHTYNAHLLIVDDDSRILALLKQFLNKNAFLVSTASSVIEAKNLLKTSNYDLIILDVMLP
EITGLEFATTIRDAGNNIPIVMLTALSEADDRVKGLEAGASDYITKPFEPRELLLRINNL
INNYNNFKKETNIIKFGNNFYNSDTKEFTKNNQIVSLSSTEQKLLEILIKNSGKSTSRFE
LSKIMGGLSMRSIDVQITRIRNKIEDNPKEPKYLKTVRNEGYALYI
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgcatacatacaacgcacatcttttaatcgttgatgatgatagcagaatattagcactt
ttaaagcaatttttaaataaaaacgcgtttttagtatcaacggcaagctcagtcatagaa
gctaaaaatctattaaaaacttctaattatgatttaattattttagatgttatgttacct
gaaataacagggcttgagtttgctactactataagggatgccggtaataatattcctata
gttatgcttactgctttatcggaagccgatgaccgtgttaaaggacttgaagccggtgcc
tctgattatataactaaaccttttgaaccgagagaattattacttcggataaataactta
atcaataattataataactttaaaaaagaaacgaatataattaaattcggcaataatttt
tataattccgatacaaaagaatttaccaagaataatcaaattgtatctcttagctctact
gaacaaaaattacttgagatattaataaaaaattccggtaaatctactagtcgttttgaa
ctgtcaaaaataatgggagggcttagtatgcgttctatcgatgtacaaattacaagaata
agaaacaaaatagaagacaacccaaaagagccgaaatatttaaaaaccgtgcgtaatgag
ggctatgcactttatatctaa

DBGET integrated database retrieval system