KEGG   Rickettsia massiliae AZT80: RMB_07045Help
Entry
RMB_07045         CDS       T01758                                 

Gene name
glyS
Definition
(GenBank) glycyl-tRNA synthetase subunit beta
  KO
K01879  glycyl-tRNA synthetase beta chain [EC:6.1.1.14]
Organism
rmi  Rickettsia massiliae AZT80
Pathway
rmi00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:rmi00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RMB_07045 (glyS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rmi01007]
    RMB_07045 (glyS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rmi03016]
    RMB_07045 (glyS)
Enzymes [BR:rmi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     RMB_07045 (glyS)
Amino acid related enzymes [BR:rmi01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   RMB_07045 (glyS)
Transfer RNA biogenesis [BR:rmi03016]
 Prokaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    RMB_07045 (glyS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_synt_2f DALR_1
Motif
Other DBs
NCBI-ProteinID: AFB32115
UniProt: H6QKB9
Position
complement(1214969..1216981)
Genome map
AA seq 670 aa AA seqDB search
MVGDEQVSELLLELFSEEIPAFMQKNAEEGYLNIFTKIFEENEIFAKVQVFVGPRRITLH
ATHLPKITLPKEEEIKGPNIEAPEAAINGFCKAHNVSKLELSTRLISNQLYYFFIKKTEE
REIKEILPEIIIEAINKYSWAKSMFWGDYKIKWIRPLRNILCIFDGEILPVQFGHLTANN
ITYGHRLTDNKKLEVTDFEDYRNKLLENHVILERTKRETIIKTGLLELASSHDLIIKEDN
RLVEEVAGLSEFPVVLLGKIPQKFLELPKEVLISSMRTHQKYFCLFDKTGNFTPYFLFVS
NGRFTNAELVIQGNEKVLSARLSDALYFCKQDIAKTLESRLGQLEAVTFHAKLGNLREKI
ERITDICNYIAPNNKDLITAARLCKSDLVSEMVGEFPDLQGIMGYYYAKHEGLNAEIAAV
IRDHYKPQGLSDNVPSGNAALLALADKLDSLVGLMIAGEAPTGSGDPYALRRQALGIIRI
ILENKLELNFNDLINFSINLYKDSSDENKNLIISFFEERAKFYFKNDYDIALINAVLDLN
LVDTNFKLDALKEFLIEDAGKQLLNAYKRASNIIGDQKITGLVDASLFSTQPEKELFEVI
QKISPQIIDSIADKDYKKALNLLSSLLTPITSFFDNVLVNDSDPKIAQNRLSLLQNICEL
FDKVAKFNRL
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atggttggagatgaacaagtgagcgagttattattagagctatttagcgaagaaattccg
gcttttatgcaaaaaaatgctgaagagggttatttaaatatattcacgaaaatttttgaa
gaaaacgaaatatttgcaaaagtgcaagtattcgtgggacctcgcaggataacgctgcat
gctacccatttgccaaagataactttgccaaaagaggaagaaattaaaggaccaaacata
gaagctccggaagccgctattaacggcttttgtaaagctcataatgttagtaaattagag
ctttctactagattaattagtaatcagctatattatttctttatcaaaaaaacagaagaa
agagaaataaaagagattttgccggagattattatagaggctattaataaatatagctgg
gcaaaatcgatgttttggggtgattacaaaataaaatggattagacctctgcgaaatatt
ttatgcatatttgacggcgaaatattaccggtgcaatttgggcatttaaccgctaataat
attacgtatgggcatcgtcttactgataataaaaaattagaagtaacagattttgaagat
tatagaaataagcttttagaaaatcatgttattttagaaagaacaaagagagagacaata
attaaaaccggtttactggaactagcaagttctcatgatttaattataaaagaagataat
cgtttagtagaagaagtagcagggcttagcgaatttcctgttgtattgcttggaaaaatc
ccgcaaaaatttttagagttacctaaagaagtacttatttcttcgatgcgtacgcatcag
aaatatttttgtttatttgataaaacaggaaatttcacaccgtattttctctttgtcagt
aatggcagatttacaaatgctgaactagttattcaaggtaacgagaaagttctatcggca
cgtctttcggatgctttatatttttgtaagcaggatatagctaaaactttagaatcaaga
ttaggccaattagaagctgtaacatttcatgcaaagcttggtaatttaagagaaaaaatt
gaacgcataaccgatatttgtaattatatagctccaaataataaggatttgattacagca
gctaggctttgcaaaagtgatcttgtttctgagatggtcggggaatttcctgatttacag
gggattatgggttattattatgcaaaacatgaagggctaaatgcagaaatagccgctgta
attagagaccattataaaccgcaaggtttgagcgacaatgtaccaagcggaaatgcggct
ttacttgctttagccgataagctagatagtttagtaggtttgatgatagcaggggaagca
ccaacaggctcaggtgatccatatgccttaagacgtcaagctcttggtataataagaata
atacttgaaaataaattagagctaaattttaatgatttaattaatttttctataaactta
tataaagattcatctgacgaaaataagaatttaataatatctttttttgaagaaagagca
aaattttactttaaaaatgactatgatattgcgttaattaatgcagttcttgacttaaat
ttagtagatacaaactttaagcttgatgcgttaaaagaatttttaatagaagacgcaggc
aagcaattattaaatgcttacaaacgagctagcaatataattggtgatcagaaaattacc
ggcttagttgatgcgagtctctttagtacacaacctgaaaaagaattatttgaagtaatc
caaaaaatttctccgcaaattatagatagtatagctgataaagattataagaaagcctta
aatttattatcgtctctattaactcccattactagcttttttgataatgtactcgttaat
gactctgatccaaagatcgctcaaaatcgtttgtcgttattacagaatatttgcgaatta
tttgataaagtagctaagtttaaccgcttatga

DBGET integrated database retrieval system