KEGG   Roseovarius mucosus: ROSMUCSMR3_00644Help
Entry
ROSMUCSMR3_00644  CDS       T04779                                 

Gene name
ribA
Definition
(GenBank) GTP cyclohydrolase-2
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
rmm  Roseovarius mucosus
Pathway
rmm00740  Riboflavin metabolism
rmm00790  Folate biosynthesis
rmm01100  Metabolic pathways
rmm01110  Biosynthesis of secondary metabolites
rmm02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:rmm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    ROSMUCSMR3_00644 (ribA)
   00790 Folate biosynthesis
    ROSMUCSMR3_00644 (ribA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ROSMUCSMR3_00644 (ribA)
Enzymes [BR:rmm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     ROSMUCSMR3_00644 (ribA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: ARE82147
UniProt: A0A1V0RK68
Position
662891..663979
Genome map
AA seq 362 aa AA seqDB search
MSLAPDLTEIAARARSDLRMGVPVVLSGRGGAALIMAAETLEAQRLADLRALGGTPVLAI
TARRATTLKARAYDDDLARVILPPDVSLGWILSVADPADDLKSPMKGPLTSERGGAVDLH
RLALSLVKSSRLLPAALVLPLTEGVEFARRHGLTLLDTAAAPQLELTSPLHPVVSARLPL
AVSEAGRLHIFRPEDGGEEHYAIEIGQPDRAVPVLARLHSACFTGDLMGSLKCDCGPQLR
GALAQMGAEGAGVLLYLNQEGRGIGLANKMRAYSLQDQGFDTVEANHRLGFEDDERDFRI
GARILSLMGFSSVRLLTNNPAKIAMMEQNGIKVIERVPLKLGENTHNHHYLATKAAKSGH
ML
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgagccttgcaccggatctcactgaaattgctgcgcgcgcacgaagcgatctgcgcatg
ggcgtgcccgtggtgctaagcggccgcggaggtgcggcactcatcatggcggccgaaacg
cttgaggcgcagcggcttgcggatctgcgggcattgggcggcactccggttctggcgatt
actgcgcgccgggccaccacgctcaaggcgcgggcctatgatgatgatctcgcgcgcgtt
atccttccgcctgatgtctctctgggatggattttgtcggttgcggacccggcggatgat
ctcaaaagcccgatgaaaggcccgctgacctccgagcgcgggggcgcggtcgatctacac
cggctggcgctgagccttgtgaaatcgtcgcggcttttgcccgccgccttggtgctgcca
ctaacggaaggcgtggaattcgcgcgccgtcatgggctgaccttgcttgatacagccgcg
gcaccgcaactcgaactgacaagcccgctgcatccggtggtcagcgcgcgcctgccgctt
gccgtgtcagaggcggggcgtctgcatatctttcgccccgaggatggtggcgaggaacat
tacgccatcgaaatcggtcaacctgaccgcgccgtgcccgtgctggcacggctgcattcc
gcctgtttcaccggcgacctgatgggaagcctgaaatgcgattgcggacctcagctgcgc
ggcgctctggcgcagatgggggccgaaggtgccggcgtgctgctgtatctcaaccaagag
gggcgcggcattggcctcgccaacaagatgcgtgcctacagcttgcaggatcagggattc
gacacggtcgaagccaatcatcgccttggatttgaagatgacgaacgcgatttccgcatc
ggtgcgcgcatcctgtcgctgatgggcttttcctcggtgcggcttcttaccaacaatccc
gccaagatcgcgatgatggagcagaacggcatcaaggtgatcgagcgtgtgccgctgaaa
ctgggcgagaacacgcataatcatcactatctcgcgaccaaggccgcaaaatcggggcat
atgctctag

DBGET integrated database retrieval system