KEGG   Roseovarius mucosus: ROSMUCSMR3_02368Help
Entry
ROSMUCSMR3_02368  CDS       T04779                                 

Gene name
phbA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rmm  Roseovarius mucosus
Pathway
rmm00071  Fatty acid degradation
rmm00072  Synthesis and degradation of ketone bodies
rmm00280  Valine, leucine and isoleucine degradation
rmm00310  Lysine degradation
rmm00362  Benzoate degradation
rmm00380  Tryptophan metabolism
rmm00620  Pyruvate metabolism
rmm00630  Glyoxylate and dicarboxylate metabolism
rmm00640  Propanoate metabolism
rmm00650  Butanoate metabolism
rmm00900  Terpenoid backbone biosynthesis
rmm01100  Metabolic pathways
rmm01110  Biosynthesis of secondary metabolites
rmm01120  Microbial metabolism in diverse environments
rmm01130  Biosynthesis of antibiotics
rmm01200  Carbon metabolism
rmm01212  Fatty acid metabolism
rmm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rmm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ROSMUCSMR3_02368 (phbA)
   00630 Glyoxylate and dicarboxylate metabolism
    ROSMUCSMR3_02368 (phbA)
   00640 Propanoate metabolism
    ROSMUCSMR3_02368 (phbA)
   00650 Butanoate metabolism
    ROSMUCSMR3_02368 (phbA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ROSMUCSMR3_02368 (phbA)
   00072 Synthesis and degradation of ketone bodies
    ROSMUCSMR3_02368 (phbA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ROSMUCSMR3_02368 (phbA)
   00310 Lysine degradation
    ROSMUCSMR3_02368 (phbA)
   00380 Tryptophan metabolism
    ROSMUCSMR3_02368 (phbA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ROSMUCSMR3_02368 (phbA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ROSMUCSMR3_02368 (phbA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ROSMUCSMR3_02368 (phbA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rmm04147]
    ROSMUCSMR3_02368 (phbA)
Enzymes [BR:rmm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ROSMUCSMR3_02368 (phbA)
Exosome [BR:rmm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ROSMUCSMR3_02368 (phbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ARE83837
UniProt: A0A1V0RPY0
Position
complement(2442432..2443607)
Genome map
AA seq 391 aa AA seqDB search
MTNVVIASAARTAVGSFGGAFANTPAHDLGAAVLEAVVARAGIEKGEVSETILGQVLTAA
QGQNPARQAHINAGLPIESAAWSINQVCGSGLRAVALGAQHIQLGDAAIVCAGGQENMTL
SPHAAYLRAGHKMGDMTYIDTMIRDGLWDAFNGYHMGQTAENVADQWQITRDVQDEFAVA
SQNKAEAAQKAGKFDEEVIAFAVKTRKGDIIVDKDEYIRHGATIDAMQKLRPAFTKDGSV
TAANASGLNDGAAATLLMSADEAERRGIEPLARIASYATAGLDPSIMGVGPIHASRKALA
KAGWTVADLDLVEANEAFAAQACAVNKEMGWDPAIVNVNGGAIAIGHPIGASGCRVLNTL
LFEMKRRGAKRGLATLCIGGGMGVALCVERP
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaccaatgtagtaatcgcatccgcagcgcgcaccgctgtcggatcttttggcggcgct
ttcgccaatacgccggcgcatgatctgggcgcagccgtgcttgaggcagtggttgcccgt
gcaggcatcgaaaagggcgaagtgtccgagacgatcctcggtcaggtgctgaccgcagcg
cagggccaaaaccccgcgcgtcaggcgcatatcaacgccggtttgccgattgaatccgcc
gcctggagcatcaatcaggtttgcggctctggtttgcgggccgtggcgctgggcgcgcag
cacatccagttgggcgatgccgccatcgtctgcgccgggggtcaggaaaacatgacactc
agcccccatgccgcctatttgcgcgccgggcacaagatgggcgatatgacctatatcgac
acgatgattcgcgatggtctgtgggatgcgttcaacggctatcacatggggcagaccgcc
gagaacgtcgccgaccagtggcagatcacccgcgacgtgcaggacgaattcgccgtggcc
agccagaacaaggccgaagccgcgcagaaggcgggcaagtttgacgaagaagtgatcgcc
tttgccgtcaagacgcgcaagggcgacatcatcgtcgacaaggatgaatacatccgccac
ggcgcgacaattgacgccatgcagaagctgcgccccgcctttaccaaggatggctcggtc
acggccgccaatgcgagcggtctgaatgacggtgcggccgcgacattgctgatgagcgcc
gatgaggccgagcggcgcgggatcgaaccgctggcgcgcattgcgtcctatgcaaccgct
gggctggacccgtcgatcatgggcgtgggtccgatccatgccagccgcaaggcgctggcc
aaggccggttggactgtcgccgatctggatctggtcgaagcgaatgaggcctttgccgcg
caggcctgtgcggtcaacaaggaaatgggctgggatccggccatcgtcaacgtgaacggc
ggcgcgattgccattggccacccgattggggcctcgggctgtcgcgtgctcaacacgctg
ttgttcgagatgaagcgccgcggtgccaagcgtggtctggccacgctctgcatcggtggc
ggcatgggcgttgcgctctgcgtcgagcgtccgtga

DBGET integrated database retrieval system