KEGG   Ralstonia mannitolilytica: TK49_02860Help
Entry
TK49_02860        CDS       T03778                                 

Definition
(GenBank) trans-aconitate methyltransferase
  KO
K00598  trans-aconitate 2-methyltransferase [EC:2.1.1.144]
Organism
rmn  Ralstonia mannitolilytica
Brite
KEGG Orthology (KO) [BR:rmn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    TK49_02860
Enzymes [BR:rmn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.144  trans-aconitate 2-methyltransferase
     TK49_02860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_31 Methyltransf_11 Methyltransf_23 Methyltransf_12 NodS MTS Methyltransf_2 FmrO CheR FtsJ Methyltransf_32
Motif
Other DBs
NCBI-ProteinID: AJW43749
Position
1:complement(587674..588453)
Genome map
AA seq 259 aa AA seqDB search
MTTQHDWSADQYVRFEEERTRPARDLLAAVPQTAIRSAVDIGCGPGNSTEALMARAPGAA
VRGFDTSADMIEAARKRLPHVDFEIADVATWNPPEPFDLILANAVLQWLPDHGTLFPKLI
GKLTQGGHLAVQMPDNLDEPTHRLMREVAADGPWAGKLKGVERTERFDPRRYYAMLSPLC
SRVDVWRTTYYHPLRGGADAVVEWLKGTGLRPFLAALNEAERPVFLARYRDAIAQAYPAL
DDGTVLLPFPRLFIVATRK
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgcagcacgattggagcgcagatcagtacgtccggtttgaagaagaacgcacg
cggcctgcccgggacttgctggccgccgtgccgcaaacggccatccgcagcgccgtcgac
atcggctgcgggccaggcaattccaccgaggcactgatggcgcgcgcgcccggcgcggcc
gtccgcgggttcgatacttcggccgacatgatcgaggccgcgcgcaagcgcctgccgcac
gtggattttgagatcgccgacgttgcgacgtggaacccgcccgaaccgttcgatctgatc
ctggcgaacgccgtgctgcaatggttgcccgatcacggcacgctgttcccgaaattgatc
ggcaaactgacgcagggcggccaccttgcggtgcagatgcccgacaacctggatgagccg
acgcaccgcctgatgcgcgaggtggctgccgacggcccgtgggccggcaagctcaagggc
gtcgaacgcacggaacggtttgacccacgccgctactacgccatgctgtcaccgctgtgc
agtcgggtggacgtatggcgcaccacgtattaccaccctctgcggggtggcgcggatgcg
gtggtggaatggctgaagggaaccggcctgcgacccttcctcgcggcgttgaacgaagcc
gaacggcccgtcttcctcgcacgctatcgcgacgcgattgcccaggcctatccggcactc
gacgatggcacggtgctgctgccgtttccgcgtctcttcatcgtggcgacgcgcaagtag

DBGET integrated database retrieval system