KEGG   Ralstonia mannitolilytica: TK49_03045Help
Entry
TK49_03045        CDS       T03778                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
rmn  Ralstonia mannitolilytica
Pathway
rmn00730  Thiamine metabolism
rmn00790  Folate biosynthesis
rmn01100  Metabolic pathways
rmn02020  Two-component system
Module
rmn_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rmn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    TK49_03045
   00790 Folate biosynthesis
    TK49_03045
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    TK49_03045
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rmn04147]
    TK49_03045
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rmn00537]
    TK49_03045
Enzymes [BR:rmn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     TK49_03045
Exosome [BR:rmn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TK49_03045
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rmn00537]
 Enzymes
  TK49_03045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase Phosphodiest
Motif
Other DBs
NCBI-ProteinID: AJW43782
UniProt: A0A2N5L292
Position
1:complement(628304..629698)
Genome map
AA seq 464 aa AA seqDB search
MNTQSNRIVRAALLALAAGACAQAHAAGEAKNVIFFLGDGMGPTTVTATRIYKVGEAGRL
TMETLKRTARIKTYSNDAQTTDSAPSMSAYMTGVKMNNEVISMSQDTKASDATGKGYVSG
ADSTCPAGNGTPAVTLLELAKAAGKSVGAVTTTRLTHATPAATYSHICHRDGENQIAAQG
TPGNALYNTALKDGVDVLLGGGRRHYVPQTTAGSKRTDTTDLIAQFQTAGYSYVSTGTQL
AAVDPASTNKLLGLFNMDHMNYELDRVKKAIDEPSLADMTEKAIRVLQKNGKGYFLMVEG
GRIDHALHGTNAKRALEDAGAFDEAIKRALSIADLQNTLIVVTADHDHTMTINGYPRKGN
PILGVSNDIKTGQPQLAADGLPYTTLVFGNGGTPRKATRDNVAAIDTTADDYLQEVGVQL
GTPGSETHGGGDVMLFSSGPGSAPLKGTLDNTKVFGVVKTAMGL
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgcaatcgaaccgtatcgtgcgcgccgcgctgctggcgctggcagccggtgcc
tgcgcccaggcgcacgccgccggcgaagccaagaacgtgatcttcttcctgggcgacggc
atgggcccgaccaccgtcactgccacgcgcatctacaaggtgggcgaggccggccgcctg
acgatggaaacgctcaagcgcacggcgcgcatcaagacgtactccaacgatgcgcagacc
accgacagcgcaccgtcgatgtcggcctacatgaccggcgtgaagatgaacaacgaagtc
atctccatgtcgcaggacacgaaggccagcgatgccaccggcaagggctacgtgagcggc
gccgactcgacctgccccgcaggcaacggcacgccggccgtgacgctgctggagctcgcc
aaggcggcgggcaagtccgtgggcgccgtcaccaccacccgcctgacgcacgccacgcca
gcggccacgtactcgcacatctgccaccgcgacggcgagaaccagatcgccgcgcaaggc
acgccgggcaacgcgctgtacaacaccgcgctcaaggatggcgtggacgtgctgctgggc
ggcggccgccgccactacgtgccacagacgaccgccggcagcaagcgcaccgacacgacc
gacctgatcgcgcagttccagaccgcgggctacagctacgtgtccaccggcacgcagctc
gccgccgttgacccggccagcaccaacaagctgctcggcctgttcaacatggaccacatg
aactacgagctggaccgcgtgaagaaggccatcgacgagcccagcctggccgacatgacc
gagaaggccatccgtgtgctgcagaagaacggcaagggctacttcctgatggtggaaggc
ggccgcatcgaccacgcgctgcacggcaccaacgccaagcgcgcgctggaagacgccggc
gcatttgacgaagcgatcaagcgcgcgctgtcgattgccgatctgcagaacacgctgatc
gtcgtgaccgccgaccacgaccacacgatgacgatcaacggctacccgcgcaagggcaac
ccgatcctgggcgtctcgaacgacatcaagaccggccagccgcaactggccgccgacggc
ctgccctacaccacgctcgtgttcggcaacggcggcacgccgcgcaaggccacgcgcgac
aacgtcgccgccatcgacaccacggcggacgactacctgcaggaagtgggcgtgcagctc
ggcacgcccggctcggaaacgcacggcggcggggatgtgatgctgttctcctctggtccg
ggcagcgcaccgctgaagggcacgctggacaacacgaaagtgttcggcgtggtcaagacg
gccatgggcctctga

DBGET integrated database retrieval system