KEGG   Ralstonia mannitolilytica: TK49_04400Help
Entry
TK49_04400        CDS       T03778                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rmn  Ralstonia mannitolilytica
Pathway
rmn00071  Fatty acid degradation
rmn00072  Synthesis and degradation of ketone bodies
rmn00280  Valine, leucine and isoleucine degradation
rmn00310  Lysine degradation
rmn00362  Benzoate degradation
rmn00380  Tryptophan metabolism
rmn00620  Pyruvate metabolism
rmn00630  Glyoxylate and dicarboxylate metabolism
rmn00640  Propanoate metabolism
rmn00650  Butanoate metabolism
rmn00900  Terpenoid backbone biosynthesis
rmn01100  Metabolic pathways
rmn01110  Biosynthesis of secondary metabolites
rmn01120  Microbial metabolism in diverse environments
rmn01130  Biosynthesis of antibiotics
rmn01200  Carbon metabolism
rmn01212  Fatty acid metabolism
rmn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rmn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TK49_04400
   00630 Glyoxylate and dicarboxylate metabolism
    TK49_04400
   00640 Propanoate metabolism
    TK49_04400
   00650 Butanoate metabolism
    TK49_04400
  09103 Lipid metabolism
   00071 Fatty acid degradation
    TK49_04400
   00072 Synthesis and degradation of ketone bodies
    TK49_04400
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TK49_04400
   00310 Lysine degradation
    TK49_04400
   00380 Tryptophan metabolism
    TK49_04400
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TK49_04400
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TK49_04400
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    TK49_04400
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rmn04147]
    TK49_04400
Enzymes [BR:rmn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     TK49_04400
Exosome [BR:rmn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TK49_04400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AJW44016
UniProt: A0A2N5L3A7
Position
1:complement(918985..920166)
Genome map
AA seq 393 aa AA seqDB search
MSDRIVIASAARTPMGAFQGELASLTAPQLGAAAIRAAVERAGLKPEQIEEVIMGCVLPA
GQGQAPARQAALGAGLPLSVGCTTVNKMCGSGMRAAMNAYDALLAGSVDVVVAGGMESMT
NAPYLIPKGRGGYRIGHGMIYDHMMLDGLEDAYEKGRAMGTFGEDCAEKYGFTREAQDHF
AMTSVRRAQEATESGAFRWEITPVTVSGKAGDTVIDTDEGPRRIKVDKIPSLKPAFKKDG
TVTAASSSSINDGAAALVMMRESTAKQLGITPLAVMLGHTTHAQEPGWFTTAPVTAIDKL
FKKLDWNSGNVDLFEINEAFAVVPMAAMHDLRIPHEKVNVNGGACALGHPIGASGARVIA
TLLGALRHRGGKRGVASLCIGGGEATAVGIELY
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaccgcatcgtcatcgcctcagcagcccgtacccccatgggcgccttccagggc
gaactcgccagcctcactgccccgcaactcggcgccgctgccattcgcgcggcggtcgaa
cgtgcgggcctgaaaccggaacagatcgaagaagtcatcatgggctgcgtgctgcctgcg
ggccaggggcaggcaccggcacgccaggccgcactgggcgcgggcctgccgctgtcggtc
ggctgcaccacggtcaacaagatgtgcgggtcgggcatgcgcgcggccatgaacgcgtat
gacgcgctgctcgcgggctcggtcgatgtggtggtcgcgggcggcatggaaagcatgacg
aatgcgccgtacctgatcccgaaaggccgtggcggttatcgcatcggccacggcatgatc
tacgaccacatgatgctcgacggcctggaagacgcctatgaaaagggccgcgccatgggc
accttcggtgaggactgcgccgagaaatacggcttcacgcgcgaagcccaggaccacttc
gcgatgacgtccgtgcgccgcgcgcaggaggccaccgaatccggcgcgttccgctgggag
atcacgcccgtcaccgtttcgggcaaagccggcgacaccgtcatcgacaccgatgaaggc
ccgcgccgcatcaaggtcgacaagatcccctcgctcaagcccgcgttcaagaaggacggc
acggtgacggccgcatcgtcttcgtcgatcaacgatggcgcagcggcgctggtgatgatg
cgcgagtcgactgccaagcagctcggcatcacaccgctggcggtgatgctcggccacacc
acgcacgcgcaagaacccggctggttcaccacggcgccggtcacggccatcgacaagctg
ttcaagaagctcgactggaactcgggcaacgtcgacctgttcgagatcaacgaggcgttt
gccgtggtgccgatggccgcgatgcacgacctgcgcatcccgcacgagaaggtgaacgtg
aacggcggcgcgtgcgcgctgggccatccgatcggtgcctcgggcgcacgtgtgatcgcg
acgctgctgggcgccctgcgacaccgcggcggcaagcgcggcgtggccagcctgtgcatt
ggcggcggcgaggccacggctgtcggcatcgaactctactaa

DBGET integrated database retrieval system