KEGG   Ralstonia mannitolilytica: TK49_10715Help
Entry
TK49_10715        CDS       T03778                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
rmn  Ralstonia mannitolilytica
Brite
KEGG Orthology (KO) [BR:rmn00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    TK49_10715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 FGGY_C
Motif
Other DBs
NCBI-ProteinID: AJW45133
UniProt: A0A2N5LA77
Position
1:2249237..2250247
Genome map
AA seq 336 aa AA seqDB search
MHTLQISLWVVVLLVALAIVFDFMNGFHDAANSIATVVSTGVLKPQQAVAMAAACNVIAI
FIFHLKVASTVGRDTIDPAIVDHYVIFGALVGAIVWNIITWYYGIPSSSSHALIGGLVGS
AVAKAGTGSLVASGLLKTVAFILISPLLGFILGSLLMVAVSWLFFRTPPSKVDRWFRRLQ
LLSASLYSLGHGGNDAQKTIGIIWMLLIAGGYASATTHEPPIWVIVCCYVAIGLGTLLGG
WRIVRTMGQKITKLKPVGGFCAETGGALTLFFASALGVPVSTTHTITGAIVGVGAAQKAS
AVRWGVAGNIVWAWILTIPASAFMAAIAWWIGKHVL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcatacgcttcagatcagtctctgggtggtcgtcctgctggtggcgctggccatcgtg
ttcgacttcatgaacggctttcacgatgccgccaactctatcgccacggtggtctcgacg
ggcgtgctcaagccgcagcaggcagtggccatggccgccgcgtgcaacgtgatcgccatt
ttcatcttccaccttaaggtggcgagcaccgtcgggcgggacaccatcgacccggcgatc
gtggatcactacgtcatttttggcgcgcttgtgggcgccatcgtgtggaacatcatcacg
tggtattacggcattccgtcgagctcgtcgcacgcgctgatcggcgggctggtcgggtcg
gccgtggccaaggccggcacgggttccctggtcgcaagcgggctgctcaagacggtcgcg
ttcatcctcatttcgccgctgctgggtttcatcctcggctcgctgttgatggtggcggtg
tcatggctattcttccgaacgccgccgtccaaggtggaccggtggttccggcgcctgcag
ttgctgtcggcgtcgctgtacagcctcggccatggcggtaacgacgcgcagaagaccatc
ggcatcatttggatgctgctcattgccggcggttatgcatcggcgacgacgcacgagccg
ccgatctgggtgatcgtctgctgctacgtggcgatcggcctgggtacgctgctcggcggc
tggcgcatcgtgcgcacgatgggtcagaaaatcaccaagctcaagccggtaggggggttc
tgcgctgaaaccggtggtgcgctgacgctgttcttcgcctccgcgctgggcgtgccggta
tcgacgacgcataccatcacgggtgcgatcgtcggtgtgggcgcggcgcagaaggcgtcg
gccgtgcgctggggcgtggcaggcaacatcgtgtgggcatggatcctgacgatccccgcc
tcggcgttcatggctgcgatcgcctggtggatcggcaagcacgtcttgtaa

DBGET integrated database retrieval system