KEGG   Rickettsia montanensis: MCI_02925Help
Entry
MCI_02925         CDS       T01784                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rmo  Rickettsia montanensis
Pathway
rmo00071  Fatty acid degradation
rmo00072  Synthesis and degradation of ketone bodies
rmo00280  Valine, leucine and isoleucine degradation
rmo00310  Lysine degradation
rmo00362  Benzoate degradation
rmo00380  Tryptophan metabolism
rmo00620  Pyruvate metabolism
rmo00630  Glyoxylate and dicarboxylate metabolism
rmo00640  Propanoate metabolism
rmo00650  Butanoate metabolism
rmo00900  Terpenoid backbone biosynthesis
rmo01100  Metabolic pathways
rmo01110  Biosynthesis of secondary metabolites
rmo01120  Microbial metabolism in diverse environments
rmo01130  Biosynthesis of antibiotics
rmo01200  Carbon metabolism
rmo01212  Fatty acid metabolism
rmo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MCI_02925
   00630 Glyoxylate and dicarboxylate metabolism
    MCI_02925
   00640 Propanoate metabolism
    MCI_02925
   00650 Butanoate metabolism
    MCI_02925
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MCI_02925
   00072 Synthesis and degradation of ketone bodies
    MCI_02925
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MCI_02925
   00310 Lysine degradation
    MCI_02925
   00380 Tryptophan metabolism
    MCI_02925
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MCI_02925
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MCI_02925
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MCI_02925
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rmo04147]
    MCI_02925
Enzymes [BR:rmo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MCI_02925
Exosome [BR:rmo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MCI_02925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AFC73467
UniProt: H8KCK9
Position
complement(501193..502371)
Genome map
AA seq 392 aa AA seqDB search
MTKPVYITYAKRTAFGSFMGSLSTTAAPMLAAHLIKDILQNSKIDPALVGEVILGQVITG
GSGQNPARQALIYAGIPKEVPGYTINKVCGSGLKSVAIAANSIMTGDNEIVIAGGQENMS
LGMHGSYIRAGAKFGDIKMVDLMQYDGLTDVFSGVFMGITAENISKQFNISRQQQDEFAL
SSHKKAAKAQLAGVFKDEILPIEVTIKKTTSLFDHDETVRPDTSLEILSKLRPAFDKNGV
VTAGNASSINDGAACLMVVSEEALKKHNLMPLARIVSYTSAGVDPSIMGTAPVPASKKAL
SKAGWSVNDLEVIEVNEAFAAQSIYVNREMKWDMEKVNVNGGAIAIGHPLGASGGRVLIT
LIHGLRRAKAKKGLVTLCIGGGMGMAMCVEAV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaccggtttatataacttatgcgaaaaggactgctttcggctcgtttatgggt
agccttagtacaacagctgcacctatgcttgctgctcatttaataaaggatatactacaa
aacagcaaaatcgatccagctttagtaggtgaggtaatccttggacaggtaataaccggt
ggtagcgggcagaatccggcgaggcaagctctgatttatgcgggaataccgaaagaagtg
ccaggctatacgattaataaagtatgcggttcaggtcttaaaagcgtagcaattgcagcg
aattcaattatgacgggtgataatgaaatagttatagcaggtgggcaggagaatatgtcg
ctcggtatgcacggtagctatatcagagcaggagctaaattcggcgatattaaaatggtt
gatctaatgcagtatgacggattaaccgatgtattttcaggagtatttatgggtattact
gccgaaaatatctcgaaacagtttaatattagcagacaacagcaggacgagtttgcctta
agctctcacaagaaagcagctaaagcacagctagcaggagtttttaaagatgaaatctta
cctatcgaagtaacgattaaaaaaactactagtttgtttgatcatgatgaaacagtaaga
cctgataccagccttgaaattttgagtaaattacgtcctgcttttgataaaaacggtgta
gttacggcgggtaatgcttcctctattaatgacggtgcggcatgtcttatggtagtttcc
gaagaagctttgaaaaagcataatttaatgccgctagctcgtattgtttcttatacttca
gccggtgttgatccaagtattatgggtactgcccctgttcctgcatccaaaaaagcttta
agtaaagcaggttggagcgttaatgatttggaagttatcgaggttaatgaggcgtttgcc
gctcaaagtatttatgtaaaccgtgaaatgaaatgggatatggagaaggttaatgttaac
ggtggagcaatagcaatcggtcatccgctcggggcaagcggcggacgtgtacttattact
ctgatacacggcttacgaagagctaaagctaaaaaaggcttagttactttatgtatcggt
ggcggtatgggtatggctatgtgcgttgaagcagtttaa

DBGET integrated database retrieval system