KEGG   Rhodothermus marinus DSM 4252: Rmar_0338Help
Entry
Rmar_0338         CDS       T01119                                 

Definition
(GenBank) ApaG domain protein
  KO
K06195  ApaG protein
Organism
rmr  Rhodothermus marinus DSM 4252
Brite
KEGG Orthology (KO) [BR:rmr00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Rmar_0338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: ACY47243
UniProt: D0ME19
Position
373909..374292
Genome map
AA seq 127 aa AA seqDB search
MVPYAATTRGVTVTVRPVYLDDPSDFFEKRFVFAYFISIENHTDEPVQLLRRYWRIEEAD
GSVREVEGAGVIGQQPVIRPGHAHIYSSYCILSSLSGTMEGYYLMRSADGRRFRVTIPRF
DLRVAAN
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atggttccctatgcagcgacaacccggggagtgacggtcaccgtacgtccggtctatctg
gatgatccgtccgactttttcgaaaagcggttcgttttcgcctatttcatcagcatcgag
aaccacacggacgagccggtgcagctcctgcgtcgctactggcgcatcgaggaagcggac
ggctcggttcgcgaggtggaaggcgccggtgtgatcggccagcaacccgtcatccggccc
ggccacgcgcacatctacagcagctactgcattctctcgtcgctcagcggcacgatggaa
ggctactacctgatgcgctcagccgacggacgccgcttccgggtgacgatccctcgtttc
gatctgcgcgtggcggccaactga

DBGET integrated database retrieval system