KEGG   Rhodothermus marinus DSM 4252: Rmar_0666Help
Entry
Rmar_0666         CDS       T01119                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
rmr00340  Histidine metabolism
rmr01100  Metabolic pathways
rmr01110  Biosynthesis of secondary metabolites
rmr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rmr00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Rmar_0666
Enzymes [BR:rmr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Rmar_0666
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh LpxD
Motif
Other DBs
NCBI-ProteinID: ACY47564
UniProt: D0MFN7
Position
762542..763873
Genome map
AA seq 443 aa AA seqDB search
MELLPIVPYEQRAERLAALWARGGTFDPEIERAVQEILQQVQQQGDAALLALTERFDGVR
PPSLRVPEAELAAAYEAMDPELKAIIAEAADNIRRFHEHQRRTSWFVEDGDGVVLGQRIV
PLERVGLYVPGGRAFYPSSLLMNAIPAQVAGVPELHLVSPPGPSGWPHPLVLATAHFLGI
RHVYAVGGAQAVAALAFGTETIPRVDKIVGPGNAYVALAKKMVFGRVDIDAVAGPSEIVV
LADDTADPEFVAADLLSQAEHDERASAVLVTPHELLAEAVRARVQRMVAEAPRRAILEVS
LARYGACIVTPSMTEAYAVVNELAPEHLELIVRDPWAALPHIRHAGAIFLGPFSTEPVGD
YFAGPNHVLPTGGTARYASALSVDDFVRSQSIIAYTAERLRRTGPRIMRFAEAEALPAHA
QAVAVRLARLAEQAPDSAVRSSA
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggaactgcttcccatagtcccctacgaacagcgcgccgagcggctggcggcgctctgg
gcgcgtggcggcacgttcgatccggaaatcgagcgggccgtgcaggagatcctgcagcag
gtgcagcagcagggtgacgccgcgctgctggcactgaccgagcgattcgacggggtgcgt
ccgccatcgctccgggtgccggaagcggagctggcggccgcgtacgaggccatggacccc
gagctgaaggccatcattgccgaggcggccgacaacatccggcgcttccacgagcaccag
cggcgcacgtcgtggttcgtcgaggacggtgacggcgtggtgctgggccagcgcatcgtg
ccgctggagcgggtgggactctacgtgccgggcggccgcgcgttctacccctccagtctg
ctgatgaacgcaatcccggcacaggtggccggcgtgccggagctgcatctggtctcgccg
ccggggccttccgggtggccgcatccgctggtgctggccaccgcccactttctgggtatt
cgtcatgtgtatgccgtgggtggagcgcaggcggtggcggcgctggccttcggtacggag
acgatcccgcgggtggataaaatcgtggggccgggcaatgcctacgtggcgctggccaag
aaaatggtcttcgggcgggtggacatcgacgccgtagccggccccagtgagatcgtcgtg
ctggccgacgacacggccgatccggagttcgtggcggccgacctgctctcgcaggccgag
cacgacgagcgggcttcggccgtgctggttacgccgcacgagctgctggccgaggcggtc
cgggcacgcgtgcagcgcatggtggccgaggcgcctcgtcgcgcgatcctagaggtgtcg
ctggcacgctacggcgcctgcatcgtgacaccgtcgatgaccgaagcgtacgcggtggtc
aacgagctggcgcccgagcacttggagctgatcgttcgggatccctgggcggcgttgccg
cacatccgccatgccggggccatctttctgggtccgttttcgacggagccggtgggcgac
tactttgccggacccaaccacgtattgcccaccggcggcacggcccgctatgcctcggcg
ctgagtgtggacgacttcgtgcggagtcagtcgatcattgcctacacggccgagcggctg
cgccggaccggtccgcgcatcatgcgcttcgccgaagccgaggcgttgccggcgcacgcc
caggcggtggccgtccggctggcccggctggcggaacaagcgccggattccgccgtgcgt
tcgtctgcctga

DBGET integrated database retrieval system