KEGG   Rhodothermus marinus DSM 4252: Rmar_1220
Entry
Rmar_1220         CDS       T01119                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K18818  mannosylglycerate synthase [EC:2.4.1.269]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
rmr00051  Fructose and mannose metabolism
rmr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rmr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Rmar_1220
Enzymes [BR:rmr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.269  mannosylglycerate synthase
     Rmar_1220
SSDB
Motif
Pfam: Glycos_transf_2
Other DBs
NCBI-ProteinID: ACY48110
UniProt: D0MI02
Structure
PDB: 

Position
1427219..1428412
AA seq 397 aa
MSLVVFPFKHEHPEVLLHNVRVAAAHPRVHEVLCIGYERDQTYEAVERAAPEISRATGTP
VSVRLQERLGTLRPGKGDGMNTALRYFLEETQWERIHFYDADITSFGPDWITKAEEAADF
GYGLVRHYFPRASTDAMITWMITRTGFALLWPHTELSWIEQPLGGELLMRREVAAMLYED
ERVRRRSDWGIDTLYTFVTVQQGVSIYECYIPEGKAHRLYGGLDDLRTMLVECFAAIQSL
QHEVVGQPAIHRQEHPHRVPVHIAERVGYDVEATLHRLMQHWTPRQVELLELFTTPVREG
LRTCQRRPAFNFMDEMAWAATYHVLLEHFQPGDPDWEELLFKLWTTRVLNYTMTVALRGY
DYAQQYLYRMLGRYRYQAALENGRGHPVPPRAALSTA
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgagcctggtcgtttttcccttcaagcacgaacaccccgaggtgctgctgcacaacgtg
cgcgtggcggctgctcatccccgggtgcacgaggtgctctgcatcggatacgagcgcgac
cagacctacgaggccgtcgaacgggccgcgcccgaaatctcgcgggccacagggacgccg
gtgtcggtccggttgcaggagcgactgggcacgctgcggcccggcaagggcgacggcatg
aacaccgcgctccggtatttcctggaagagacgcagtgggagcgcatccacttctacgat
gccgacatcaccagcttcgggccggactggatcaccaaggccgaagaggcggccgatttc
ggctacgggctggtgcggcactacttcccgcgggcctcaaccgacgcaatgatcacttgg
atgatcacgcgcacgggctttgccctgctctggccgcataccgaactgtcgtggatcgag
cagccgctgggcggcgagctgctcatgcggcgcgaagtggccgccatgctttacgaggat
gaacgggtgcgacggcggagcgactggggcatcgacacactctacacgttcgttaccgtg
cagcagggcgtttcgatctacgagtgctacattcctgagggcaaggcgcatcgcctctac
ggcgggctcgacgacctgcgcaccatgctggtcgagtgttttgccgccatccagagtctg
caacatgaggtcgttggccagccggccattcatcgccaggagcacccgcaccgcgtgccg
gtccacattgccgaacgcgtgggctacgacgtggaggccacgctgcatcgcctcatgcag
cactggacgccccggcaggtggagctgctggagctttttaccacacccgtgcgcgaagga
ctgcgcacctgtcagcgtcgcccggctttcaacttcatggacgagatggcctgggcggcc
acctatcacgtgctgctcgagcactttcagccgggcgatccggactgggaggagctgctc
ttcaaactctggacgacccgcgtgctcaactacacgatgacggtcgcgctgcggggctac
gactacgcgcagcagtatctctaccggatgctgggacgctaccgctatcaggccgctctg
gaaaacggccgtggtcatccggtcccgccgcgggcggcactgtcgaccgcctga

DBGET integrated database retrieval system