KEGG   Rhodothermus marinus DSM 4252: Rmar_2298Help
Entry
Rmar_2298         CDS       T01119                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
rmr00030  Pentose phosphate pathway
rmr00480  Glutathione metabolism
rmr01100  Metabolic pathways
rmr01110  Biosynthesis of secondary metabolites
rmr01120  Microbial metabolism in diverse environments
rmr01130  Biosynthesis of antibiotics
rmr01200  Carbon metabolism
Module
rmr_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
rmr_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:rmr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Rmar_2298
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Rmar_2298
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rmr04147]
    Rmar_2298
Enzymes [BR:rmr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     Rmar_2298
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     Rmar_2298
Exosome [BR:rmr04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Rmar_2298
  Exosomal proteins of colorectal cancer cells
   Rmar_2298
  Exosomal proteins of bladder cancer cells
   Rmar_2298
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: ACY49177
UniProt: D0MEE9
Position
complement(2660814..2662268)
Genome map
AA seq 484 aa AA seqDB search
MEGNDVTLVILGATGDLTRRLLMPAIYRLFVRAQWQPRHIVGYGRSEWTDERFREHLEKS
LKEFAREDFERKSWKELAARLTYRPGELHAEHLQGLAELVEGPAIFYLALPPGLFGEAAE
ALGQAGLHREDDGWRRIVIEKPFGSDLESALALHRQIHRYWQESQVYRIDHYLGKETVQN
LMVFRFANRFIEPVWNAAHVEQVQITVAETLGLEGRWRYYDQAGALRDMLQNHLMQLFTL
TAMEPPAVWHPEVLRDHKVEVLRAVRPIPETAVERFAARGQYAAGTVQGQQVPGYREEPN
IPRDSRTETFAAVKFFVDTWRWKGVPFYLRSGKRLRADYSEVAIGFREVPTHLFRQTPLE
GLSANWLIFRLKPSECIDLYAWARAPGLQLNARHLVLSAPFRQDDEPEFSAYEQLLLDVV
RGDRTHFLRHDEVEWAWRVLDPVLKAWQHGAPEPYAAGGEGPTGQHRILEPGHVWRPIGK
LDNP
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggaaggaaacgatgttacgctggtcattctgggcgccaccggcgacctgacgcgccgg
ttgctcatgccggccatctaccggctgttcgtccgggcgcagtggcagccccggcacatc
gtgggctacggccgcagcgaatggaccgacgaacgctttcgtgagcacctcgaaaaaagc
ctgaaggagttcgcccgggaggatttcgaacgcaaatcctggaaggaactggccgcgcgc
ctgacctaccgtccgggcgagctgcacgccgagcacctgcagggactggctgagctggtg
gagggtccggccatcttttacctggcgcttccgcccggactgtttggcgaggccgccgaa
gccctgggccaggccggactgcaccgcgaggacgacggctggcgccgcatcgtcatcgaa
aaaccgttcggctcggatctcgaatcggccctggcgctgcaccgccagatccatcgctac
tggcaggagagccaggtgtaccgcatcgaccactacctgggcaaagagaccgtccagaac
ctgatggtcttccgcttcgccaaccggtttatcgagccggtatggaatgcggcccacgtc
gagcaggtgcagatcacggtggccgaaacgctgggactggaaggccgctggcgctactac
gatcaggccggtgcgctgcgcgacatgctgcagaaccacctgatgcagctctttacgctc
acggccatggagccgccggccgtctggcaccccgaagtgctgcgcgaccacaaggtggag
gtgctgcgggccgttcgccccattcccgagacggccgtcgagcgcttcgccgcccgggga
cagtacgcggccggcaccgtgcagggccagcaggtgccgggctaccgcgaggagcccaac
atcccccgcgattcgcgcaccgaaacgttcgcggccgtcaagttctttgtggacacctgg
cgctggaagggcgtaccgttctatctgcgcagcggcaaacgcctgcgggccgattactcc
gaggtggccatcggctttcgtgaggtgcccacgcacctgttccggcagacgccgctcgaa
gggctgagcgccaactggctgatctttcggctgaagccttccgaatgcatcgacctgtac
gcctgggcccgggcgcccggcctccagctcaacgcccgccacctggtactctcggcgccg
ttccgccaggacgacgagcccgaattcagcgcctacgagcagctgctgctcgacgtcgtg
cgcggcgaccgcacgcactttctgcgacacgacgaggtggaatgggcctggcgcgtgctc
gaccccgtgctgaaggcctggcagcacggggcgcccgaaccctatgcggccggcggcgaa
ggcccgaccggccagcatcgcatcctcgaacccggccacgtgtggcgccccatcggcaaa
ctcgacaacccatga

DBGET integrated database retrieval system