KEGG   Rhodothermus marinus DSM 4252: Rmar_2450
Entry
Rmar_2450         CDS       T01119                                 
Name
(GenBank) 3-oxoacyl-(acyl-carrier-protein) reductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
rmr00061  Fatty acid biosynthesis
rmr00780  Biotin metabolism
rmr01100  Metabolic pathways
rmr01110  Biosynthesis of secondary metabolites
rmr01212  Fatty acid metabolism
rmr01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:rmr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Rmar_2450
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Rmar_2450
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Rmar_2450
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rmr01004]
    Rmar_2450
Enzymes [BR:rmr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     Rmar_2450
Lipid biosynthesis proteins [BR:rmr01004]
 Fatty acid synthase
  Component type
   Rmar_2450
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Epimerase 3HCDH_N THF_DHG_CYH_C
Other DBs
NCBI-ProteinID: ACY49328
UniProt: D0MF72
Position
complement(2848938..2849687)
AA seq 249 aa
MIVGRLNGKVAIVTGGARGIGRATATLFAREGAAVVVADRDGEVAGALADALQAEGARAW
ALSVDVTRPEQVEQMARETAEHFGRIDILVNNAGVTQDATLRKMTLEQFRAVLEVNLTGV
FLCTKAVLPYMEAQGGGCILNASSVVAHAGNFGQTNYVAAKAGVIGMTKTWARELGRYGI
RVNAVAPGFIETDMTRDVPEKVLDMVRARTPLGRMGRPEEVARAYLFLASDEASFITGAV
LNVDGGLTL
NT seq 750 nt   +upstreamnt  +downstreamnt
ttgatcgtgggaagactgaacggaaaagttgccatcgtgacggggggtgcgcgcgggatc
ggtcgggccaccgcgacgctgttcgcccgagagggggcggccgtcgtggtggccgatcgg
gatggtgaggtggctggagccctggccgatgcgttgcaggccgaaggcgcccgcgcgtgg
gccctgtcggtcgacgtgacccgacccgaacaggtcgagcaaatggccagggagaccgcc
gagcactttggacgcatcgacattctcgtcaacaacgcgggcgtcacgcaggatgccacg
ctgcgcaagatgacgctggagcagttccgggccgtcctggaggtcaatctgacgggcgtc
tttctgtgcacgaaggcggtgttgccctacatggaagcgcagggcggcggctgcattctg
aacgcttcgtccgtggtggcgcacgcgggcaatttcggtcagacgaactacgtggccgcg
aaggcgggtgtgatcggcatgacgaagacctgggcgcgggagctgggacgctacggcatc
cgggtcaacgccgtggcgcccggcttcatcgagaccgacatgacccgagacgtgcctgaa
aaggtgctcgatatggtccgagcgcgcacgccgctcgggcgcatgggacgtcccgaggaa
gtggcccgcgcctacctgtttctggcctcggacgaggcgtcgttcatcacgggcgcggtg
ctcaacgtggatggtggactaaccctgtga

DBGET integrated database retrieval system