KEGG   Rickettsia massiliae MTU5: RMA_0729
Entry
RMA_0729          CDS       T00605                                 
Symbol
traF
Name
(GenBank) F pilus assembly protein TraF
  KO
K12057  conjugal transfer pilus assembly protein TraF
Organism
rms  Rickettsia massiliae MTU5
Brite
KEGG Orthology (KO) [BR:rms00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rms02044]
    RMA_0729 (traF)
Secretion system [BR:rms02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   RMA_0729 (traF)
SSDB
Motif
Pfam: TraF Thioredoxin_8 DUF1638 FAD_binding_1 Thioredoxin_3
Other DBs
NCBI-ProteinID: ABV84877
UniProt: A8F1U1
Position
722212..723123
AA seq 303 aa
MIIVLIQIYLIKIMKWLVNTITKSSLAITLLVINLWLLINDWSNHAFAGTIELDSSNKNE
MIRFNVNNQFWQRPQGFLWYNEDHVYKQEILKFSQDKKKQEPELEPYDQRIEALKKEFTR
AQRQALDNPTLENVIIAQRLHKQILEKSHKFATMWQLATILDYKLVNMDEPVNSLHKKLY
EVRQEEENSKKLRFLAKNWGLILQINQGCNYCQAFTPIVREFADKYGFQLIFVSNSETRF
QGMPTIKDTGLLQTLNPENIVPVLYLVDSSGTQIYPVARGIISEDKIAENILAVVQHHSS
AAS
NT seq 912 nt   +upstreamnt  +downstreamnt
ataataattgtactgattcaaatttatcttattaaaataatgaagtggctagtaaacaca
ataactaaatcatcactagccattacattactagtaattaatttatggttattaatcaat
gattggtcaaatcatgcatttgctggtactatagagttagatagtagtaataaaaatgag
atgatcaggtttaatgtaaataatcagttttggcaacgacctcaagggtttttatggtat
aacgaggatcatgtttacaagcaagaaatattaaaattttctcaagataaaaaaaagcaa
gagccagaacttgagccttatgatcaaaggatagaagctttaaagaaggaatttactaga
gctcagcgtcaagctcttgataatcctactcttgaaaatgttattattgctcaaaggtta
cataaacaaattttagaaaaatcacataaatttgctaccatgtggcaactagcaacgata
ttagattacaagctagtaaacatggatgaaccagtaaattccttacataaaaaattatat
gaagtaaggcaagaagaagaaaacagcaaaaaactaagatttttagctaagaattgggga
ttaattctgcaaataaatcaaggatgcaattactgtcaggcatttacccctattgtaaga
gaatttgcagataaatatggctttcaattaatttttgtaagtaatagtgaaactagattt
caagggatgccaaccattaaagataccggtttgttacaaacactaaatccagaaaatatt
gtaccggtattatatttagtcgatagcagcggcacacaaatatatccagttgcacgaggt
attattagtgaagataaaatcgctgaaaatattttagcagtagtacagcaccacagtagt
gcagcatcatga

DBGET integrated database retrieval system