KEGG   Rickettsia massiliae MTU5: RMA_0730Help
Entry
RMA_0730          CDS       T00605                                 

Gene name
traH
Definition
(GenBank) F pilus assembly protein TraH
  KO
K12072  conjugative transfer pilus assembly protein TraH
Organism
rms  Rickettsia massiliae MTU5
Brite
KEGG Orthology (KO) [BR:rms00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rms02044]
    RMA_0730 (traH)
Secretion system [BR:rms02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   RMA_0730 (traH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraH tRNA-synt_His
Motif
Other DBs
NCBI-ProteinID: ABV84878
UniProt: A8F1U2
Position
723138..724478
Genome map
AA seq 446 aa AA seqDB search
MIMSNDYQFRNTKFLMKQVIHIVIIVLLLQPPISYAWDLQDVFEGMSVNVTKPGTYQSQA
AGYYAAGGLSLRTNKTSFNPISIIPPSLNMSCSGIDAYLGSFSIISGEELVQLMKNIGSQ
AKAYAFSLGLKTFAPQIENALKDLRNLAMEMNQFAKGDCEMTKALFASILPKDSAMRESV
CKDLQSSSGLDYFAAGKKCRSDLEQKQALASIQNKDPELMLTNYNIFTKAAEKAGIPENM
RSAIMSMTGTIIVRDNNVYFLESLAQDEKSWIAHLKGGESASIYTCDNIHCLNPAIRRNI
TIAPDQSYQGKAKTKLDELKSKLASNNEFSNADITFLSSIGEAFPIYDYITLEAISGVTI
LDSSSELVASYSVLQHLKEVISEVRKAVTMLKSKQVADHHLNAYLKALDRVQFFARDKWS
HMLTSSDQIDRRARLIEQHLIAKEKA
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgattatgagcaatgactatcagttcagaaacactaagtttctcatgaagcaggttatt
catattgtaataatagttttacttctgcaaccacctatttcttacgcatgggatttacag
gatgtatttgaaggaatgagcgttaatgtcactaagcctggaacgtatcaatctcaagct
gccggctattatgcggcaggaggattatccttgcgaactaataagacatcttttaatccc
atttctataattcctccctcattaaacatgagctgtagtggtatagatgcttatcttggt
agtttttcgattatttcaggtgaagagctggtacagctgatgaaaaatattggctcgcaa
gcaaaagcttatgcattttcattgggtcttaagacctttgctccacaaatagaaaatgcc
ttaaaagatttaagaaatcttgctatggaaatgaatcaatttgctaagggagattgtgaa
atgactaaggctctttttgcttccattttgcctaaagattcagcaatgagagaatcagtt
tgtaaagatttacaatccagctctggtttggattattttgctgccggcaaaaaatgtcgt
agtgatttagagcaaaagcaagctttagccagcatccaaaataaagatccagaattaatg
ctgacaaattataatatctttactaaagcagcagaaaaagcaggcatccctgaaaatatg
agaagtgccattatgtcaatgacaggcactattatagttagagataataatgtttatttc
cttgagtcacttgctcaagatgaaaagagctggattgctcatttaaaaggcggcgaatct
gcctcaatttatacttgtgataatattcattgtttaaatccagcaataagacgtaatatt
actattgctccagatcaatcatatcaaggcaaggctaaaacaaaactagatgaattaaag
agtaaactggcaagcaacaatgagtttagtaatgccgatattactttcttatcttcaata
ggggaagcatttccaatatatgattatattactttagaggcaatatctggagtaactatt
ttagatagttcttcagaattagttgccagttatagtgtgctgcagcatttaaaggaggta
atctcagaggtcagaaaagcagttaccatgctcaaatcaaagcaagtagcagatcatcat
ttaaacgcctacttaaaagctttagatcgagtgcaattttttgccagagataaatggagt
catatgttaactagtagcgatcagattgatagaagagcaagattaatagagcaacattta
atcgccaaagagaaggcttaa

DBGET integrated database retrieval system