KEGG   Rothia mucilaginosa: RMDY18_02190Help
Entry
RMDY18_02190      CDS       T01144                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rmu  Rothia mucilaginosa
Pathway
rmu00010  Glycolysis / Gluconeogenesis
rmu00020  Citrate cycle (TCA cycle)
rmu00620  Pyruvate metabolism
rmu01100  Metabolic pathways
rmu01110  Biosynthesis of secondary metabolites
rmu01120  Microbial metabolism in diverse environments
rmu01130  Biosynthesis of antibiotics
rmu01200  Carbon metabolism
Module
rmu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rmu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RMDY18_02190
   00020 Citrate cycle (TCA cycle)
    RMDY18_02190
   00620 Pyruvate metabolism
    RMDY18_02190
Enzymes [BR:rmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     RMDY18_02190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_3 HlyD_D23
Motif
Other DBs
NCBI-ProteinID: BAI64051
UniProt: D2NQX5
Position
231270..232745
Genome map
AA seq 491 aa AA seqDB search
MSQIFPLPDVGEGLTEAEILSWKVAVGTEVAINDVLVEIETAKSVVELPSPFAGTVEALL
VAEGETVEVGTPIISISGGDNAPATPAAPAAAEAESGTALVGSGPKADAVKRRARKRPAS
AAQPAQAVAAPVAPAVQAPVAHTPADSANRNQGLLSELAERASRFVENTPLNSVVQRLAP
EPAAAPAPTLAPEQVPHRPTLAPPPVRLAAKELGVDLANVTATGARGQVTKQDLMNYVAH
LSDVQHSGARQPFWQPAATPGDRIERIPVRGVRKATAKAMVASAFSAPHVSIFVDVDASR
TMEFVKRLKKSRHFEGVKVTPLLVLAAAVIWAAERNPQVNATWTDSEIQIKHFMNLGIAA
ATPRGLMVPNIKDAQELSLRELAIALNNLTTRAREGKTQPAEMANGTLTITNIGSLGIDT
GTPIINPGEVAIVAFGTIKQKPWVVDGEVIPRWVTTLGGSFDHRVVDGDLSARFMADVAA
ILEEPALLLDH
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagattttcccgctccctgacgtgggcgaaggcctgaccgaagcagaaatcctc
agctggaaggtggcagtcggcaccgaggtcgccatcaacgacgtcctcgtcgaaattgaa
accgcgaagagcgtcgtggaactaccctcgcccttcgccggcaccgtcgaggcgctgctc
gttgccgaaggcgaaaccgttgaggtgggcaccccgatcatcagcatctccggcggcgac
aacgcacccgcaaccccggcggcacccgccgcggcagaggctgagtccggcaccgcactg
gtcggctccggccccaaggcggacgctgtgaagcgccgcgcccgcaagcgccccgcctcc
gcggcccagcccgcacaggctgttgcggcaccggtcgcaccggctgttcaggcacccgtg
gcgcacacccccgccgactcggcgaaccgcaaccagggcctgctgagcgagctggctgag
cgcgcctcccgctttgtggagaacaccccgctgaactcggtggtgcagcgtctggcaccc
gagcccgcagcggctcccgcgccgactttggctcctgagcaggttccgcaccgcccgacc
ctcgcgccgcctccggtgcgtcttgccgcaaaggagctgggtgttgacctggcgaacgtg
accgctaccggtgcgcgcggccaggtgaccaagcaggacctcatgaactatgtggcgcac
ctgagcgatgtgcagcatagcggcgcccgccagccgttctggcagcccgcagccaccccc
ggtgaccgcattgagcgcatcccggtgcgtggcgtgcgtaaggctaccgcgaaggcgatg
gttgcttcggcgtttagcgccccgcacgtgtccatcttcgtggatgttgatgcctcccgc
accatggagttcgtgaagcgtttgaagaagtcccgccactttgagggtgtgaaggtcacc
ccgctgctggtgcttgccgccgcggtcatttgggctgctgagcgtaacccgcaggtcaac
gcgacctggaccgatagcgaaatccagattaagcacttcatgaacctgggtattgctgcg
gcgaccccgcgcggcctgatggttccgaacattaaggacgctcaggagctgtccctgcgt
gagctggctatcgcgctgaacaacctgaccactcgcgcccgtgagggtaagactcagccc
gctgagatggcgaacggcaccctgaccattacgaacatcggttcgctgggtattgatacg
ggtaccccgattattaaccccggtgaggtggcgattgttgccttcggtacgatcaagcag
aagccgtgggttgttgatggtgaggttattcctcgctgggtgacgaccctgggtggctcg
ttcgaccaccgtgtggtggatggcgacctgtcggctcgttttatggctgatgtggctgcg
attcttgaggagcctgccttgctgctggaccactag

DBGET integrated database retrieval system