KEGG   Rothia mucilaginosa: RMDY18_02690Help
Entry
RMDY18_02690      CDS       T01144                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rmu  Rothia mucilaginosa
Pathway
rmu00020  Citrate cycle (TCA cycle)
rmu00640  Propanoate metabolism
rmu00660  C5-Branched dibasic acid metabolism
rmu01100  Metabolic pathways
rmu01110  Biosynthesis of secondary metabolites
rmu01120  Microbial metabolism in diverse environments
rmu01130  Biosynthesis of antibiotics
rmu01200  Carbon metabolism
Module
rmu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rmu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RMDY18_02690
   00640 Propanoate metabolism
    RMDY18_02690
   00660 C5-Branched dibasic acid metabolism
    RMDY18_02690
Enzymes [BR:rmu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     RMDY18_02690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A CPSase_L_D2 CIDE-N PASTA ATP-grasp TauD
Motif
Other DBs
NCBI-ProteinID: BAI64101
UniProt: D2NR25
Position
281450..282736
Genome map
AA seq 428 aa AA seqDB search
MCAGCERPLSHRTDHTGEPPLMRPGRVHQYSAPLRRRRTPVDLFEYQARELFAKHGVPVL
KGIVATTPEEAKAAAEEIGGLTVIKAQVKTGGRGKAGGVKLAKSPEEAYEHAKAILGMDI
KGHTVHRVLVADGADIAEEYYFSLLLDRANRSYLAMCSVEGGMEIEQLAAERPEALAKIE
VDPLVGLDQAKAEEIAKAAGFSAELQEKVVPVLVKLGEVYTKEDATLVEVNPLVLTPEGT
ILALDGKVSLDDNAEFRQPEHEALVDKSAENPLEAKAKQFDLNYVKLDGEVGIVGNGAGL
VMSTLDVVAYAGENHGNVKPANFLDIGGGASAEVMAAGLEIILGDEQVKSVFVNVFGGIT
ACDAVADGIVKALEILGDAATKPLVVRLDGNNVAEGRRILSEANHPLVVLAETMDSGADK
AAELAHKA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
gtgtgcgccgggtgcgagagacccctatcgcaccgtactgaccacacgggggaacctcct
ctaatgagaccaggccgagtgcaccagtactcggcaccacttcgaagaagaaggacacct
gtggaccttttcgaataccaggcgcgcgagctcttcgcaaagcacggtgtacccgtgctc
aagggcattgttgcgaccacccctgaagaagcaaaggcagcagctgaggaaattggcggc
ctgaccgtcattaaggctcaggttaagaccggcggccgcggtaaggctggcggcgttaag
ctcgcaaagtcccccgaagaagcttacgagcacgctaaggcaattctcggcatggacatc
aagggccacaccgttcaccgcgtgctggtcgctgacggcgcagacatcgccgaagaatac
tacttctccctcctgctggaccgtgcaaaccgctcctacctggcaatgtgctcggtagaa
ggcggtatggaaattgagcagctcgctgctgagcgccccgaggcactggcaaagatcgag
gttgacccgctggtcggcctggaccaggctaaggctgaggaaattgctaaggcagcaggt
ttctccgcagaactgcaggagaaggttgttcccgttctcgttaagctgggcgaagtctac
accaaggaagacgcaaccctggttgaggttaaccccctcgttctgacccccgagggcacc
atcctcgccctggacggcaaggtctccctggacgacaacgcagaattccgccagcccgag
cacgaggctctcgtggacaagtccgctgagaacccgctggaagctaaggcaaagcagttc
gacctgaactacgtgaagctggacggcgaggtcggcatcgttggtaacggtgcaggtctg
gttatgtccaccctggacgtcgttgcatacgctggcgagaaccacggcaacgtcaagccc
gcaaacttccttgatattggtggcggcgcgtccgctgaggttatggctgccggcctggaa
atcattctgggcgacgagcaggtcaagagcgttttcgtgaacgtcttcggcggcatcacc
gcatgtgacgcagtggcagacggcattgtgaaggctctggagattctgggcgacgcagca
accaagcccctggttgtgcgcctggacggcaacaacgttgctgagggtcgccgcatcctc
tccgaggcgaaccacccgctggttgttctggctgagaccatggactccggcgctgacaag
gcagcagagctcgctcacaaggcgtaa

DBGET integrated database retrieval system