KEGG   Rothia mucilaginosa: RMDY18_07540Help
Entry
RMDY18_07540      CDS       T01144                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
rmu  Rothia mucilaginosa
Pathway
rmu00450  Selenocompound metabolism
rmu00970  Aminoacyl-tRNA biosynthesis
rmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    RMDY18_07540
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RMDY18_07540
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rmu01007]
    RMDY18_07540
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rmu03016]
    RMDY18_07540
Enzymes [BR:rmu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     RMDY18_07540
Amino acid related enzymes [BR:rmu01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   RMDY18_07540
Transfer RNA biogenesis [BR:rmu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    RMDY18_07540
 Prokaryotic type
   Other AARSs
    RMDY18_07540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f Cytochrom_C_2
Motif
Other DBs
NCBI-ProteinID: BAI64586
UniProt: D2NSG0
Position
807228..808772
Genome map
AA seq 514 aa AA seqDB search
MTATPFYITTAISYPNGNPHIGHAYETIAADVLARFKRLDGFDVRFMTGTDEHGQKMQTT
AEKLGKTAKELADENSARFKAMNDALNISYDRFIRTTDPDHYVASQAIWKRMEENGDIYL
DKYAGWYSVRDEAYYAEDETEVRDGQRYAIATGTEVEWTEEESYFFRLSKYGDKLLELYA
NEGFVYPESRRNELISFVKGGLNDLSISRTTFDWGVPVPGNDKHVMYVWVDALTNYITGL
GYPDTDNELFAKYWPADLHLIGKDITRFHSIYWPAFLWSAGIELPKRVFGHGFLLVNGEK
MSKSVGNVVDPANLVDAFGLDAVRFFLMREVSFGQDGSYSEESIINRINSDLANNLGNLA
QRSLSMVAKNCGGAVPAHGEFTEADRQILDEAAALYEPVRADFDEQAFHRALDRIWTVLA
DTNAYFAEQEPWTLRKNGELDRMNTVLYVTLEVVRQVALLLQPVMPDSTAKLLTLLGVPE
GESRQFAALGTALVPGTELPAPAPVFPRYEAPKA
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaactccgttctacatcaccaccgccatctcctaccccaatggcaacccgcac
atcggccacgcctacgaaaccatcgcagccgacgtgctagcccgcttcaagcgcctcgac
ggcttcgacgtgcgcttcatgaccggcaccgacgagcacggccagaagatgcagaccacc
gccgaaaaactcggtaagaccgctaaggaactcgccgacgagaactccgcacgcttcaaa
gcaatgaacgacgcgctgaacatcagctacgaccgcttcatccgcaccaccgaccccgac
cactacgtcgcatcccaggccatctggaagcgcatggaagaaaacggcgacatctacctc
gacaagtacgccggctggtactccgtacgcgacgaagcctactacgcagaagacgaaacc
gaagtacgcgacggccagcgctacgccatcgccaccggcaccgaagtcgaatggaccgaa
gaagaatcctacttcttccgcctctccaagtacggcgacaagctcctcgaactctacgcc
aacgaaggcttcgtctaccccgaatcccgccgcaacgaactgatttccttcgtcaagggc
ggcctcaacgacctgtccatctcccgcaccaccttcgactggggcgtacccgtacccggc
aacgacaagcacgtcatgtacgtgtgggtcgacgccctcaccaactacatcaccggcctc
ggctaccccgacaccgacaacgaactgttcgccaagtactggcccgccgacctgcacctc
atcggcaaggacatcacccgattccactccatctactggcccgcattcctgtggtccgcc
ggaatcgaactgcccaagcgcgtgttcggccacggcttcctgctcgtcaacggcgagaag
atgtccaagtccgtcggtaacgtcgtcgaccccgcaaacctcgtcgacgcgttcggcctg
gacgcggtgcgcttcttcctcatgcgtgaagtgtccttcggtcaggacggctcctactcc
gaagagtccatcatcaaccgcatcaactccgacctggcaaacaacctcggcaacctcgcc
cagcgttcgctgtccatggtcgccaagaactgcggcggtgccgtccccgcccacggcgaa
ttcaccgaagctgaccgccagatcctcgacgaggcggcagccctctacgagcctgtccgt
gcagacttcgacgagcaggcattccaccgcgcactcgaccgcatctggaccgtcctcgca
gacaccaacgcctacttcgcggagcaggaaccctggaccctgcgcaagaacggcgaactc
gaccgcatgaacaccgtgctgtacgtgacgctcgaggtcgtgcgccaggtcgccctgctg
ctgcagcccgttatgcccgactcgaccgccaagctgctgaccctgctcggcgtacccgaa
ggcgagtcccgccagttcgcagccctcggcaccgcgctcgtgcccggcaccgagctgccc
gcacccgcaccggtgttcccccgttacgaagcacccaaggcataa

DBGET integrated database retrieval system