KEGG   Rothia mucilaginosa: RMDY18_10670Help
Entry
RMDY18_10670      CDS       T01144                                 

Definition
(GenBank) threonine dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
rmu  Rothia mucilaginosa
Pathway
rmu00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:rmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    RMDY18_10670
Enzymes [BR:rmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     RMDY18_10670
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     RMDY18_10670
    1.1.1.-  
     RMDY18_10670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AdoHcyase_NAD ADH_zinc_N_2 NAD_binding_3 FAD_binding_3 ADH_N_2
Motif
Other DBs
NCBI-ProteinID: BAI64899
UniProt: D2NTC3
Position
1164418..1165650
Genome map
AA seq 410 aa AA seqDB search
MRMPAGQFTTGPNHVVWASVNTVTDPWMRTVPASTHRSERHNHAKELHPMKAARFYDRND
IRIEDIPAPEAAAGEVLVKVAWCGICGTDLHEYLDGPIFCPQHGHPHPISGEDSPVTLGH
EFSGVVEALGEGVDDLEVGDHVVVEPYIIRDDVYTGPDSKDYHLSKDMNFIGLAGRGGGL
SEKVAVKRRWVHKIPNNIPLDEAALIEPLSVGYHAVERAGEFEEGAFALVTGAGPIGLLT
SAVLKAKGAKVIISELSPLRRQKALDSGVADYAFSPAEVDVLAEIHKLTDGRGADIAFEC
TSVQPALDLILDALKPTGKVVIVSIWGKPASLDVQKVVLKELDIRGTIAYVNSHPETIKL
VESGKIDLKPFITGKIAVEDLIDKGFDTLINHNETAVKILVTTDPERLAE
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatgccggcaggacagttcacaaccggtccaaaccatgtcgtttgggcctctgtc
aataccgtgacagacccatggatgcgaaccgtaccggcaagcacacaccgcagtgagcgc
cataaccacgctaaggagctccatcccatgaaggcagcacgcttctacgaccgtaacgac
atccgcattgaagacatccccgcacctgaagccgctgcgggcgaggttctggtcaaggtc
gcatggtgcggtatttgcggtaccgacctgcacgaatacctcgacggccccatcttctgc
ccccagcacggtcacccccaccccatttctggcgaggactcccccgtcaccctcggtcac
gaattctccggtgttgttgaggcactgggcgaaggcgtagacgaccttgaggttggcgac
cacgttgtcgtcgagccctacatcattcgtgatgacgtctacaccggccccgactccaag
gactaccacctgtctaaggacatgaacttcattggtctggcaggtcgcggtggcggtctg
tccgagaaggttgctgtcaagcgtcgctgggttcacaagattcctaacaacattcccctg
gacgaggctgcactgattgagcccctgagcgttggctaccacgctgttgagcgtgcaggc
gagttcgaagagggcgcattcgcactggtgaccggtgctggccccatcggtctgctgacc
tccgcagttctgaaggctaagggcgctaaggttatcatctctgagctgtccccgctgcgc
cgccagaaggctctggactccggcgttgctgactacgctttctcccccgcagaggttgac
gttctggctgagattcacaagctgaccgacggccgtggcgctgatatcgcgttcgagtgc
acctccgttcagcccgcactggacctgatcctggatgctctcaagcccaccggtaaggtt
gtcatcgtctccatttggggcaagcccgcttccctggatgttcagaaggttgtgctcaag
gagctcgatatccgcggtaccatcgcatacgtgaactcccacccggagaccatcaagctc
gttgagtccggcaagattgacctcaagcccttcatcaccggcaagattgctgtggaagac
ctgattgacaagggcttcgacaccctgatcaaccacaacgagaccgctgtgaagattctg
gtcaccaccgacccggagcgtctggctgagtaa

DBGET integrated database retrieval system