KEGG   Rothia mucilaginosa: RMDY18_16220Help
Entry
RMDY18_16220      CDS       T01144                                 

Definition
(GenBank) uncharacterized protein
  KO
K18455  mycothiol S-conjugate amidase [EC:3.5.1.115]
Organism
rmu  Rothia mucilaginosa
Brite
KEGG Orthology (KO) [BR:rmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    RMDY18_16220
Enzymes [BR:rmu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.115  mycothiol S-conjugate amidase
     RMDY18_16220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIG-L
Motif
Other DBs
NCBI-ProteinID: BAI65454
UniProt: D2NP86
Position
complement(1822357..1823328)
Genome map
AA seq 323 aa AA seqDB search
MSEAIEQLKANLPTHPPVEAIKPLEEDYTGLRILAVHAHPDDESSKGAGTASAYIARGAR
FMVATMTGGERGDILNEEIDKSPRAHRDLPGLRRAEMAAAREIMGIEHRWIGFFDSGLPE
GDPMPPLPFGSFGTMPLDRAAAPLVRLVREYRPHIIITYDEIGGYPHPDHIMTHKVAVEA
FEKAGDPEAYVGEGEPWTPLKLYYDRAFNPERTLALHEHLLDTHGESLLSGWIENLAHRA
SSGEAPRHETTTRILVTDHFEQRDQALRAHASQVDPNGVFFAVPSEQLKDIWPWEDYTLA
ASHAEVQLPESSLDEGLSDYYVI
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaagccatcgaacagctgaaggcgaacctgccgactcaccctcccgtcgaggct
attaagccgctggaggaggactacaccggtctgcgcatcctggccgtgcacgcacacccg
gacgacgagtcctccaagggcgccggtaccgcctcggcgtatattgcccgtggtgcccgc
ttcatggtggcgacgatgaccggcggcgagcgcggtgacatcctgaatgaggagatcgat
aaaagcccgcgtgcgcaccgcgacctaccgggtctgcgccgcgccgagatggcggctgcc
cgcgagattatgggtattgaacaccgctggattggcttcttcgactctggtctgcccgag
ggcgaccccatgccgccgcttcccttcggtagcttcggcaccatgcccctggaccgtgcc
gccgcgccgctcgtgcgtctggtgcgtgagtaccgcccgcacatcatcatcacctatgac
gagatcggcggctacccgcaccccgaccacatcatgacccacaaggttgccgtagaagca
ttcgagaaggcaggcgacccggaagcctacgtgggtgagggcgagccctggaccccgctg
aagctctattacgaccgcgcattcaaccccgaacgcaccctcgccctgcacgagcatctg
ctcgatacgcacggtgagagcctgctgagcggctggattgagaacctcgcgcaccgcgcc
tcctcgggggaggcgcctcgccacgagactacgacccgcatcctggtgaccgaccacttt
gagcagcgcgatcaggctttgcgcgcgcacgcatcgcaggtggacccgaacggcgtgttc
ttcgccgttcccagcgaacagctgaaggatatttggccttgggaggactacacgctggcc
gcctcgcacgctgaggttcagctgcccgaatctagcctggacgagggcctgagcgactac
tacgtcatctag

DBGET integrated database retrieval system