KEGG   Rothia mucilaginosa: RMDY18_16380Help
Entry
RMDY18_16380      CDS       T01144                                 

Definition
(GenBank) enolase
  KO
K01689  enolase [EC:4.2.1.11]
Organism
rmu  Rothia mucilaginosa
Pathway
rmu00010  Glycolysis / Gluconeogenesis
rmu00680  Methane metabolism
rmu01100  Metabolic pathways
rmu01110  Biosynthesis of secondary metabolites
rmu01120  Microbial metabolism in diverse environments
rmu01130  Biosynthesis of antibiotics
rmu01200  Carbon metabolism
rmu01230  Biosynthesis of amino acids
rmu03018  RNA degradation
Module
rmu_M00002  Glycolysis, core module involving three-carbon compounds
rmu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rmu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RMDY18_16380
  Energy metabolism
   00680 Methane metabolism
    RMDY18_16380
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    RMDY18_16380
Enzymes [BR:rmu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     RMDY18_16380
Messenger RNA biogenesis [BR:rmu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     RMDY18_16380
Exosome [BR:rmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   RMDY18_16380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Enolase_C Enolase_N MR_MLE_C MAAL_C
Motif
Other DBs
NCBI-ProteinID: BAI65470
UniProt: D2NPA2
Position
complement(1837900..1839180)
Genome map
AA seq 426 aa AA seqDB search
MAVITAVHARQILDSRGNPTVEVEVLLEDGAFARAAVPSGASTGEWEAVERRDGDKSVYL
GKGVLGAVKSVIEEIAEEVIGIEASDQRAVDAAMIALDATNNKGKLGANAILGVSLAVAK
AAAESADLPLYKYLGGPNAHVLPVPMMNILNGGSHADSNVDIQEFMIAPIGFDNYSDALR
AGVEVYHSLKSVLHDRGLATGLGDEGGFAPNLESNAAALDLIVEAIEKAGYKPGEQVALA
LDVASSEFYNDGAYEFEGQKKSAAEMSAYYADLVAKYPLVSIEDPLDENDWEGYKTLTEQ
IGDKVQIVGDDLFVTNPERLARGIEEGAANALLVKVNQIGSLTETLDAMELAQRHEYRCM
VSHRSGETEDVTIADLAVATNAGQIKTGAPARSERVAKYNQLLRIEEELGEAAVYAGKSA
FPRFKA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggctgttattaccgcagttcacgcacgccagatcctggattcccgtggcaacccgacc
gttgaggttgaggttctgctcgaagacggtgctttcgcacgcgcagctgtgccctcgggc
gcatccaccggtgagtgggaagctgttgagcgccgcgatggcgacaagtccgtatacctg
ggcaagggtgttctgggcgcagtgaagtctgttatcgaagaaatcgctgaagaggtcatc
ggcattgaggcttccgaccagcgcgctgttgacgcagccatgatcgctctggatgcaacc
aacaacaagggcaagctgggtgcaaacgcaatcctgggtgtctccctggctgttgctaag
gctgctgctgagtccgctgacctacccctgtacaagtacctcggtggcccgaacgctcac
gttctgcccgtccccatgatgaacatcctcaacggtggttctcacgcagactccaacgtt
gacattcaggagttcatgattgctcccatcggcttcgacaactactctgacgctctgcgc
gcaggtgttgaggtttaccactccctgaagtccgtgctgcacgaccgcggcctggcaacc
ggcctgggcgacgagggtggcttcgcacccaacctggagtccaacgcagctgcactggac
ctgattgttgaggcaatcgagaaggctggctacaagccgggcgagcaggttgcactggct
cttgacgttgcttcctccgagttctacaacgacggcgcatacgagttcgagggccagaag
aagtccgcagctgagatgagcgcatactacgctgacctcgttgcaaagtacccgctggtt
tccatcgaggatcccctggatgagaacgactgggagggctacaagaccctgaccgagcag
atcggtgacaaggtccagatcgtcggtgacgacctgttcgtgaccaaccccgagcgtctg
gctcgcggtatcgaagagggcgcagctaacgctctgctcgtgaaggtgaaccagatcggt
tcgctgaccgagaccctcgacgcaatggagctggcacagcgccacgaataccgttgcatg
gtttctcaccgttccggtgagaccgaggacgtcaccatcgccgacctggctgttgcaacc
aacgctggccagatcaagaccggtgctcccgcacgttccgagcgcgttgctaagtacaac
cagctgctgcgcattgaggaagagctgggcgaggcagctgtttacgctggcaagtccgca
ttcccccgcttcaaggcataa

DBGET integrated database retrieval system