KEGG   Rothia mucilaginosa: RMDY18_18340Help
Entry
RMDY18_18340      CDS       T01144                                 

Definition
(GenBank) acyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rmu  Rothia mucilaginosa
Pathway
rmu00010  Glycolysis / Gluconeogenesis
rmu00620  Pyruvate metabolism
rmu00640  Propanoate metabolism
rmu00680  Methane metabolism
rmu01100  Metabolic pathways
rmu01110  Biosynthesis of secondary metabolites
rmu01120  Microbial metabolism in diverse environments
rmu01130  Biosynthesis of antibiotics
rmu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rmu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RMDY18_18340
   00620 Pyruvate metabolism
    RMDY18_18340
   00640 Propanoate metabolism
    RMDY18_18340
  Energy metabolism
   00680 Methane metabolism
    RMDY18_18340
Enzymes [BR:rmu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     RMDY18_18340
Lipid biosynthesis proteins [BR:rmu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   RMDY18_18340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: BAI65666
UniProt: D2NPU8
Position
2066962..2069115
Genome map
AA seq 717 aa AA seqDB search
MLMPATDGRKMGLPTPYSFTDPLNPTPNPALESDEARVAFWEKQAQRLTWAEPWHTAHRF
EKPKSLGFDEDGIEQFSIPEIKWFEGGKLNVAYNCVDRHVEAGRGDKVALYFEGEPGDRE
AITYAELQRRIAKAANGLLSLGVRKGDRVVIYLPVIPETIIFTLACARIGAIHSLVFGGF
SAEALKFRVEDTGAKVLITTDGQNRRGKVVPVKVNADEACSGENNIEHVIVVDRTSASDP
VEHAAVPWTEGRDVWYHDLVDDQPDTHAYELHDAEDPLFIIYTSGTTGKPKGLVHTMAGY
LVQTAYTHALLYDLLPDYVDENGVLRPDELSAVNDPEKVESTVHWCTADLAWVTAHTYEI
YGPLVNGVSEVIYEGTPNTPHFGRHFEVIERYGVTNYYTAPTLIRSLMGAFPNGPEPGKY
DFSTVRLLGSVGESINPEAWRWLRQHVGGGTAAFIDTWWQSETGSTVCSPRPHDPAFAPE
GTYPEGTPHCTPLPGCATRAVPGVSTRVVDEHGDPVEPGKQGFIVVDKIGPSMARTVWQN
PQRFLDSYWRHYGERGWFLAGDGAKEDEEGNVYILGRIDDVINISGHRLSTIEIESALVT
HPAVVEAGVCPVEDELTGHQAVAYVTLTDEGKDLTEDELKAALTAHVREHIGPIAKPKDV
VAVADIPKTRSGKITRRLLGELYQGRSLGDVSSLQNEEALGHIAQVLVDTGRVSEAV
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
gtgctaatgccagcaaccgatgggagaaaaatgggactgcccaccccctactcgttcacc
gacccgctgaaccccaccccgaaccccgccctcgaatctgacgaggcacgcgtcgcgttc
tgggagaagcaggcgcagcgcctcacctgggctgagccctggcacaccgcgcaccgtttc
gagaaaccgaagtccctcggcttcgacgaggacggcatcgaacagttcagcatccccgaa
attaagtggttcgagggcggtaagctcaacgtcgcttacaactgcgtggaccgccacgtg
gaggcgggccgcggcgacaaggtagccctctactttgaaggtgaacccggagaccgcgaa
gccatcacctacgcagagctgcagcgccgcatcgcgaaggcagcgaacggtctgctgtcc
ctgggcgtgcgcaagggtgaccgtgtggtcatctacctgcccgtcatccccgaaaccatt
attttcactctcgcctgcgcgcgtattggcgcgatccattccctcgtcttcggtggtttc
tccgctgaggcgctgaagttccgtgtggaagacaccggcgcgaaggttctcatcaccacc
gacggtcagaaccgccgcggcaaggtcgttcccgtgaaggtgaacgccgacgaagcttgc
tccggtgagaacaatattgagcacgttatcgtggtggaccgcaccagtgcctccgacccg
gtggagcacgccgctgtgccgtggactgagggccgcgacgtctggtaccacgacctggtg
gacgaccagccggacacccacgcctacgaactgcacgacgccgaggacccgctgttcatt
atttacacctccggcacgaccggtaagcccaagggcctggtgcacaccatggctggatac
ctggtgcagaccgcgtacactcacgcgctgctctacgatttgctgccggattacgtggac
gagaacggcgtgctgcgcccggacgagctgtccgcggtcaacgacccggaaaaggttgag
tccaccgttcactggtgcaccgccgacctggcgtgggttaccgcgcacacctacgaaatc
tacggcccgctggttaacggtgtctccgaggtgatttacgagggtaccccgaacaccccg
cacttcggccgccactttgaggtcatcgaacgctacggcgtgaccaactactacaccgcc
ccgaccctgattcgttccctcatgggtgcgttcccgaacggcccggagcccggcaagtac
gacttctcgaccgtgcgtctgctcggttcggtgggtgaatccattaacccggaggcgtgg
cgttggctgcgtcagcacgtgggcggcggcaccgcggcgttcatcgacacctggtggcag
tccgagaccggttcgaccgtatgctccccgcgcccgcacgacccggcattcgcgcccgag
ggcacctacccggagggcaccccgcactgcactcccctgcccggttgcgctacccgcgcc
gttcccggcgtgtccacccgcgtggtggatgagcacggcgacccggtcgaacccggcaag
cagggcttcatcgtggtcgataagattggcccctcgatggctcgtaccgtgtggcagaac
ccgcagcgtttcctggattcctattggcgtcactacggcgagcgcggctggttcctcgct
ggcgacggcgcgaaggaagacgaagagggtaacgtgtacatcctcggccgtattgatgac
gtgattaacatttcgggtcaccgcctgtccacgattgagattgagtcggctctggtgact
cacccggctgtggttgaggctggtgtctgccccgtggaggatgagctgaccggtcaccag
gcggtcgcctacgtgacgctcaccgatgagggtaaggacctgactgaggatgagctgaag
gcggcgctgaccgcgcacgtgcgtgagcacattggcccgattgctaagccgaaggacgtt
gtggcggttgccgatatcccgaagacccgttcgggtaagattactcgccgtctgctcggt
gagctgtaccagggccgttcgctgggcgatgtttcttcgctgcagaatgaggaggcgctg
ggccacattgcgcaggtgctggtggataccggccgcgtgagcgaggctgtctag

DBGET integrated database retrieval system