KEGG   Rattus norvegicus (rat): 100124593
Entry
100124593         CDS       T01003                                 

Gene name
Cxcr6
Definition
(RefSeq) C-X-C chemokine receptor type 6
  KO
K04191  C-X-C chemokine receptor type 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100124593 (Cxcr6)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100124593 (Cxcr6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    100124593 (Cxcr6)
   04050 Cytokine receptors [BR:rno04050]
    100124593 (Cxcr6)
   04090 CD molecules [BR:rno04090]
    100124593 (Cxcr6)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    100124593 (Cxcr6)
Cytokine receptors [BR:rno04050]
 Chemokine receptors
  CXC Chemokine
   100124593 (Cxcr6)
CD molecules [BR:rno04090]
 Proteins
  100124593 (Cxcr6)
SSDB
Motif
Pfam: 7tm_1 Peroxin-13_N 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 100124593
NCBI-ProteinID: NP_001096057
RGD: 1642118
Ensembl: ENSRNOG00000006319
UniProt: A7ISD5
Position
8
AA seq 351 aa
MDDGHQEKDLDDDVYGGDPWLFNNSSGNSQEHKRFLKFKEVFLPCMYLVVFVLGLLGNSL
VLIIYIFYQRLRSLTDVFLLNLPLADLVFVCTLPFWAYAGTYEWVFGTAMCKTLRSMYAM
NFYVSMLTLTCITVDRFVVVVQATKAFNRQAKWKIWGQVTCLLIWVVSLLVSLPQIIYSR
VGHIDRLICQFHNEAISTVVLVLQMTLGFFLPLLTMILCYSGIIKTLLHARNFQKHKSLK
IIFLVVATFLLTQTPFNIAMLIQWISWEYSTITSFQYVVLVTEAIAYLRACLNPVLYAFV
GLKFRKNLWKLMKDISCLSRLGVSSQWKSSEDNSKTCSASHNAETTSMFQL
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggatgatgggcatcaagagaaagatctggacgatgacgtctacgggggagatccctgg
ctcttcaacaactccagtggtaacagccaggaacacaaacgcttcctaaagttcaaggag
gtttttctgccctgcatgtatctggtagtgtttgtccttggactgctagggaactccctg
gttctgattatatacattttctaccagaggctgaggagtctgacagacgtgttcctgctg
aacttgcccctggctgacctggtgtttgtctgtactctgcccttttgggcctacgcaggc
acctatgagtgggtctttggcacagccatgtgcaaaactcttcgaagcatgtatgcaatg
aacttctacgtgtccatgctcactctcacctgcatcacggtggatcgtttcgttgtagtg
gtccaggctaccaaggccttcaacaggcaggctaagtggaagatctggggccaagtcact
tgcttgctcatctgggtagtctccctgctggtttctttgccacagatcatctacagcaga
gttggacatattgacaggcttatctgtcagttccacaacgaggcgatatcgactgtggtt
cttgttctacagatgactctggggttcttcctgccattgctcactatgattctgtgctac
tcaggcattatcaagaccttgcttcacgctcgaaacttccagaagcacaaatctctaaag
atcatcttccttgtagtggctacgttcctgctgacccagacacccttcaacattgccatg
ttaatccagtggataagttgggaatacagtaccataaccagctttcagtatgtcgtctta
gtgacagaggcgatagcataccttcgggcctgccttaaccctgtactctatgcctttgtt
ggcttaaagttccggaagaacctctggaaacttatgaaggacatcagctgcctctctcgt
ctgggagtctcaagtcagtggaagtcttctgaggacaattccaagacttgttctgcctcc
cacaatgcagagaccaccagtatgttccaattgtaa

KEGG   Rattus norvegicus (rat): 117027
Entry
117027            CDS       T01003                                 

Gene name
Ccr3
Definition
(RefSeq) C-C chemokine receptor type 3
  KO
K04178  C-C chemokine receptor type 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno05163  Human cytomegalovirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    117027 (Ccr3)
   04061 Viral protein interaction with cytokine and cytokine receptor
    117027 (Ccr3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    117027 (Ccr3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    117027 (Ccr3)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    117027 (Ccr3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    117027 (Ccr3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    117027 (Ccr3)
   04050 Cytokine receptors [BR:rno04050]
    117027 (Ccr3)
   04090 CD molecules [BR:rno04090]
    117027 (Ccr3)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    117027 (Ccr3)
Cytokine receptors [BR:rno04050]
 Chemokine receptors
  CC Chemokine
   117027 (Ccr3)
CD molecules [BR:rno04090]
 Proteins
  117027 (Ccr3)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 117027
NCBI-ProteinID: NP_446410
RGD: 620593
Ensembl: ENSRNOG00000006736
UniProt: O54814
Position
8
AA seq 359 aa
MASNEEELKTVVETFETTPYEYEWAPPCEKVSIRELGSWLLPPLYSLVFIVGLLGNMMVV
LILIKYRKLQIMTNIYLLNLAISDLLFLFTVPFWIHYVLWNEWGFGHCMCKMLSGLYYLA
LYSEIFFIILLTIDRYLAIVHAVLALRARTVTFATITSIITWGLAVLAALPEFIFHESQD
NFGDLSCSPRYPEGEEDSWKRFHALRMNIFGLALPLLIMVICYSGIIKTLLRCPNKKKHK
AIQLIFVVMIVFFIFWTPYNLVLLLSAFHSTFLETSCQQSIHLDLAMQVTEVITHTHCCI
NPIIYAFVGERFRKHLRLFFHRNVAIYLRKYISFLPGEKLERTSSVSPSTGEQEISVVF
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggcatccaacgaagaggaactcaagactgttgttgaaacctttgagaccacaccctat
gaatatgagtgggcaccaccctgtgaaaaagtcagcatcagagagctggggtcatggctc
ctgcctccactgtattccctggtgttcatcgtcggcctcctgggcaacatgatggttgtg
ttgatcctcataaagtacaggaagctgcaaattatgactaatatctacctactcaacttg
gcaatttctgacctgctctttctcttcactgtcccattctggattcactatgttctgtgg
aatgagtggggttttggccactgcatgtgtaaaatgctctctgggctttattacctggcc
ttgtacagcgagatctttttcatcatcctgctgacaatcgacaggtacctggctatcgtt
catgctgtgttggcccttcgagcacgaactgtgacttttgctactatcaccagcatcatc
acttggggtcttgcagtattggcagcattgcctgaatttatcttccatgagtcccaagac
aattttggagatctttcctgcagtcctcgctatccagagggcgaagaagacagctggaag
cgtttccatgctctaagaatgaacatttttggtttagctcttcctctcctcattatggtt
atctgctactcaggaatcattaaaactctgcttagatgccccaataaaaaaaaacacaag
gccatccagcttatttttgttgtcatgatagtcttttttattttttggactccatacaac
ctggttcttcttctgtctgctttccacagcacatttttggagaccagctgtcagcagagc
atacacctggacctggccatgcaagtgactgaggtgattacccacacccactgctgtatc
aatccaataatctatgcctttgttggtgagaggttccggaaacaccttcggctctttttc
cacagaaatgtggcaatctacctgagaaaatatatttcattccttcctggcgagaaactg
gaaagaacaagctctgtctccccatcaactggggagcaagaaatctctgtggtgttttag

KEGG   Rattus norvegicus (rat): 117029
Entry
117029            CDS       T01003                                 

Gene name
Ccr5
Definition
(RefSeq) C-C chemokine receptor type 5
  KO
K04180  C-C chemokine receptor type 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04144  Endocytosis
rno05145  Toxoplasmosis
rno05163  Human cytomegalovirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05170  Human immunodeficiency virus 1 infection
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    117029 (Ccr5)
   04061 Viral protein interaction with cytokine and cytokine receptor
    117029 (Ccr5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    117029 (Ccr5)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    117029 (Ccr5)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    117029 (Ccr5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    117029 (Ccr5)
   05163 Human cytomegalovirus infection
    117029 (Ccr5)
   05167 Kaposi sarcoma-associated herpesvirus infection
    117029 (Ccr5)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    117029 (Ccr5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    117029 (Ccr5)
   04050 Cytokine receptors [BR:rno04050]
    117029 (Ccr5)
   04090 CD molecules [BR:rno04090]
    117029 (Ccr5)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    117029 (Ccr5)
Cytokine receptors [BR:rno04050]
 Chemokine receptors
  CC Chemokine
   117029 (Ccr5)
CD molecules [BR:rno04090]
 Proteins
  117029 (Ccr5)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx 7TM_GPCR_Srab
Other DBs
NCBI-GeneID: 117029
NCBI-ProteinID: NP_446412
RGD: 620596
Ensembl: ENSRNOG00000049115
Vega: OTTRNOG00000001625
UniProt: O08556 Q68G28
Position
8
AA seq 354 aa
MDFQGSIPTYIYDIDYSMSAPCQKFNVKQIAAQLLPPLYSLVFIFGFVGNMMVFLILISC
KKLKSMTDIYLFNLAISDLLFLLTLPFWAHYAANEWVFGNIMCKLFTGIYHIGYFGGIFF
IILLTIDRYLAIVHAVFAIKARTVNFGVITSVVTWVVAVFVSLPEIIFMRSQKEGSHYTC
SPHFPRIQYRFWKHFQTLKMVILSLILPLLVMVICYSGILNTLFRCRNEKKRHRAVRLIF
AIMIVYFLFWTPYNIVLLLTTFQEYFGLNNCSSSNRLDQAMQVTETLGMTHCCLNPVIYA
FVGEKFRNYLSVFFRKHIVKRFCKHCSIFQQVNPDRVSSVYTRSTGEQEVSTGL
NT seq 1065 nt   +upstreamnt  +downstreamnt
atggattttcaagggtcgattccaacctatatctatgacatcgattatagtatgtcagca
ccctgccaaaaattcaatgtgaaacaaattgcagcccagctcctgcccccactctactct
ctggtattcatctttggttttgtgggtaacatgatggtcttcctcatcctgataagctgc
aaaaagctgaagagcatgactgatatctacctgttcaacctggccatctctgacctgctc
ttcctgctcacactcccattctgggctcactatgctgcaaatgagtgggtctttgggaat
ataatgtgcaaattattcacagggatctatcacattggttattttggtggaatcttcttc
attatcctcctgacaattgataggtacttggctattgtccatgctgtgtttgctataaaa
gccagaacagtcaactttggggtaataacaagtgtagtcacttgggtggtggctgtgttt
gtctctctcccagaaataatctttatgagatctcaaaaagaaggttctcattatacatgc
agtcctcattttccacgtattcaatatcgtttctggaagcattttcaaacattaaagatg
gtcatcttgagcctgatcctacccctacttgtcatggtcatctgctattcaggaatcctc
aacaccctgtttcgctgtaggaatgagaagaagaggcacagggctgtaaggctcatcttt
gccatcatgattgtctactttctcttctggactccctacaacattgtcctcctcctgacc
accttccaggaatactttggactgaataattgcagtagttctaatagactagaccaggca
atgcaggtgacagagactcttgggatgacacactgctgcctcaaccctgtcatctatgcc
tttgttggggagaagttccggaattatctctctgtgttcttccgaaaacacattgtcaaa
cgcttctgcaaacactgttcaattttccagcaagtcaatcctgatcgtgtaagctcagtc
tatacccggtccacaggagaacaggaagtttctactggtttatga

KEGG   Rattus norvegicus (rat): 171054
Entry
171054            CDS       T01003                                 

Gene name
Ccr4
Definition
(RefSeq) C-C chemokine receptor type 4
  KO
K04179  C-C chemokine receptor type 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    171054 (Ccr4)
   04061 Viral protein interaction with cytokine and cytokine receptor
    171054 (Ccr4)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    171054 (Ccr4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    171054 (Ccr4)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    171054 (Ccr4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    171054 (Ccr4)
   04050 Cytokine receptors [BR:rno04050]
    171054 (Ccr4)
   04090 CD molecules [BR:rno04090]
    171054 (Ccr4)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    171054 (Ccr4)
Cytokine receptors [BR:rno04050]
 Chemokine receptors
  CC Chemokine
   171054 (Ccr4)
CD molecules [BR:rno04090]
 Proteins
  171054 (Ccr4)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 171054
NCBI-ProteinID: NP_598216
RGD: 620594
Ensembl: ENSRNOG00000010315
UniProt: Q91ZH4
Position
8
AA seq 360 aa
MNATDVTDTTQDEAAYNSYYFDESLPKPCTKEGIKAFGEVFLPPLYSLVFLLGLFGNSVV
VLVLFKYKRLKSMTDVYLLNLAISDLLFVLSLPFWGYYAADQWVFGLGLCKIISWMYLVG
FYSGIFFIMLMSIDRYLAIVHAVFSLRARTLTYGVITSLITWSVAVFASLPGLLFSTCDT
ENNHTYCKTQYSVNSTTWKVLSSLEINVLGLVIPLGIMLFCYSMIIRTLRHCKNEKKNRA
VRMIFAVVVLFLGFWTPYNVVLFLETLVELEVLQDCTLERYLDYAIQATETLAFIHCCLN
PVIYFFLGEKFRKYIAQLFRTCRGPPVLCQHCDFLQISSADTSSSSYTQSTVDHDFRDAL
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgaatgccacagatgtcacagacaccacccaggatgaagccgcgtacaatagttactac
ttcgacgagagcttgccaaagccttgcaccaaggaaggcatcaaggcgttcggcgaggtc
ttcctgcctcctctctactccttggtctttctgttgggtctgtttgggaattctgttgtg
gttctggtgctgttcaagtacaagaggctcaagtccatgactgacgtgtacctgctgaac
ctagccatctcggatttactgtttgtgctgtctctcccgttctggggctactatgctgct
gaccagtgggtttttggtctaggtctgtgtaagattatctcatggatgtacctggtgggc
ttctacagcgggatcttcttcatcatgctcatgagtatagacagatacctggccatcgtg
cacgcagtgttttccttgagagcgaggactctgacctatggggtcatcaccagcctcatc
acgtggtctgtggctgtgtttgcctccctaccaggcctcttgttcagcacctgcgacaca
gagaacaaccacacatactgcaaaacccagtactcggtcaactcgaccacgtggaaagtc
ctcagctccctggagatcaatgtcttggggctggtcatccccctggggatcatgttgttc
tgctattccatgatcatcaggaccctgagacactgcaagaatgagaagaagaacagagca
gttcggatgatcttcgccgtggtggtcctcttcctcggcttctggacgccgtacaacgtg
gtgcttttcctggagaccttggtggagctcgaagtccttcaggactgcaccttggagagg
tacctagactatgccatccaggccacagaaaccctggccttcattcactgctgccttaac
cctgtcatttacttcttccttggggagaaattccgcaagtacatcgcccaactcttcaga
acgtgccggggtcctcctgtgctctgccaacactgtgacttccttcagatctcctcggcc
gacacttccagctcctcttacactcagtccactgtggatcatgacttccgtgacgctttg
taa

KEGG   Rattus norvegicus (rat): 171056
Entry
171056            CDS       T01003                                 

Gene name
Cx3cr1
Definition
(RefSeq) CX3C chemokine receptor 1
  KO
K04192  CX3C chemokine receptor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    171056 (Cx3cr1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    171056 (Cx3cr1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    171056 (Cx3cr1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    171056 (Cx3cr1)
   04050 Cytokine receptors [BR:rno04050]
    171056 (Cx3cr1)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Chemokine
   CX3C Chemokine
    171056 (Cx3cr1)
Cytokine receptors [BR:rno04050]
 Chemokine receptors
  CX3C Chemokine
   171056 (Cx3cr1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 171056
NCBI-ProteinID: NP_598218
RGD: 620137
Ensembl: ENSRNOG00000018509
UniProt: P35411
Position
8
AA seq 354 aa
MPTSFPELDLENFEYDDSAEACYLGDIVAFGTIFLSIFYSLVFTFGLVGNLLVVLALTNS
RKSKSITDIYLLNLALSDLLFVATLPFWTHYLISHEGLHNAMCKLTTAFFFIGFFGGIFF
ITVISIDRYLAIVLAANSMNNRTVQHGVTISLGVWAAAILVASPQFMFTKRKDNECLGDY
PEVLQEIWPVLRNSEVNILGFVLPLLIMSFCYFRIVRTLFSCKNRKKARAIRLILLVVVV
FFLFWTPYNIVIFLETLKFYNFFPSCGMKRDLRWALSVTETVAFSHCCLNPFIYAFAGEK
FRRYLRHLYNKCLAVLCGRPVHAGFSTESQRSRQDSILSSLTHYTSEGEGSLLL
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgcctacctccttcccggaattggatctagagaactttgagtatgatgactctgctgag
gcctgttatttgggtgacatcgtggcctttgggaccatcttcctatctattttctactcc
cttgtcttcacgttcggtctggtggggaatctgttggtggtcctcgccctcaccaacagc
cggaagtccaagagcatcactgacatctacctcctgaacctggccttgagcgacctgctc
tttgtggccactttgcccttctggactcactacctcatcagccatgagggcctccacaac
gccatgtgcaagctcacgactgctttcttcttcattggcttctttgggggcatattcttc
atcaccgtcatcagcatcgaccggtacctcgccatcgtcctggccgccaactccatgaac
aaccggacagtgcaacacggcgtcaccatcagtctgggcgtctgggcggcggccatctta
gtggcgtcgccccagttcatgttcacaaagagaaaggacaacgaatgtttgggtgattac
cccgaggtcctgcaggaaatctggcccgtgctccgcaactcggaggtcaacatcctgggc
ttcgtcctgcccttgcttatcatgagcttttgctacttccgcatcgtccggacgctgttt
tcctgcaagaaccggaagaaggccagagccattaggctcatcctcttggtggttgttgtc
ttcttcctcttctggacgccttacaacatcgtgattttcctggagactctcaaattctac
aacttcttccctagttgtggcatgaagagggacctgaggtgggcccttagtgtgacggag
acagtggcgtttagccactgctgcctcaacccctttatctacgctttcgctggggaaaag
ttcagaaggtacctgagacacctgtacaacaagtgcctggccgtcctgtgcggtcgtcct
gtccacgccggcttctcaacagagtcccagaggagcaggcaggacagcattctgagcagc
ttgactcactacacaagcgagggagagggatctctcctgctctga

KEGG   Rattus norvegicus (rat): 282832
Entry
282832            CDS       T01003                                 

Gene name
Ccr9
Definition
(RefSeq) C-C chemokine receptor type 9
  KO
K04184  C-C chemokine receptor type 9
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    282832 (Ccr9)
   04061 Viral protein interaction with cytokine and cytokine receptor
    282832 (Ccr9)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    282832 (Ccr9)
   04062 Chemokine signaling pathway
    282832 (Ccr9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    282832 (Ccr9)
   04050 Cytokine receptors [BR:rno04050]
    282832 (Ccr9)
   04090 CD molecules [BR:rno04090]
    282832 (Ccr9)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    282832 (Ccr9)
Cytokine receptors [BR:rno04050]
 Chemokine receptors
  CC Chemokine
   282832 (Ccr9)
CD molecules [BR:rno04090]
 Proteins
  282832 (Ccr9)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 282832
NCBI-ProteinID: NP_758832
RGD: 628750
Ensembl: ENSRNOG00000006311
UniProt: Q8CH33
Position
8
AA seq 369 aa
MTPTEFTSLIPGMFDDYSYDSTASTDDYMNLNFSSFFCKKNNVRQFASHFLPPLYWLVFV
VGTVGNSLVILVYWYCTRVKTMTDMFLLNLAIADLLFLATLPFWAIAAAGQWMFQTFMCK
VVNSMYKMNFYSCVLLIMCISVDRYIAIVQAMKAQVWRQKRLLYSKMVCITIWVMAAVLC
TPEILYSQISGESGIAICTMVYPKDKNAKLKSAVLILKVTLGFFLPFMVMAFCYTIIIHT
LVQAKKSSKHKALKVTITVLTVFIMSQFPYNCILVVQAVDAYTMFISNCTISTNIDICFQ
VTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRREGSLKLSSMLL
ETTSGALSL
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgacacccacagaattcacaagccttattcctggcatgtttgatgactacagctatgat
tccactgcttccacagacgactacatgaatttgaacttcagtagcttcttctgtaagaaa
aacaatgtaaggcagtttgcgagtcatttccttccgcctctgtactggcttgtgttcgtt
gtgggtactgtgggcaacagcctggtcatccttgtctactggtactgcacaagagtgaag
acaatgaccgacatgttccttttgaatttggccattgctgatctgctctttcttgccact
cttcccttctgggccattgctgctgctggtcagtggatgttccagaccttcatgtgcaag
gttgtgaacagcatgtacaagatgaacttctacagctgtgtgctactcatcatgtgcatc
agtgtggacagatacattgccattgtacaggccatgaaggctcaggtctggaggcagaaa
aggctgctgtacagcaagatggtctgcattaccatctgggtgatggcagctgtgctctgc
accccagaaatcctgtacagtcaaatcagtggggaatctggcattgccatatgtaccatg
gtctaccctaaggataagaatgccaagctaaagtctgctgttttgatcctgaaggtcacc
ttggggtttttcctccccttcatggtcatggctttctgttacaccatcatcattcatact
ttggtacaggccaagaagtcatccaagcacaaggccctcaaggtgaccatcactgttctc
actgtcttcattatgtctcagttcccctacaattgcattctggtagtgcaggctgttgat
gcctacaccatgttcatctccaactgcaccatttccaccaacattgacatctgcttccag
gttactcagactattgcattcttccacagttgcctgaacccagttctctatgttttcgtg
ggtgagagattccgcagggatctggtaaagaccctgaagaacctgggatgcattagccag
gcccagtgggtttcattcacaaggagagagggtagcttgaagctttcttctatgctactg
gagacaacttctggagctctctccctgtga

KEGG   Rattus norvegicus (rat): 287673
Entry
287673            CDS       T01003                                 

Gene name
Ccr7
Definition
(RefSeq) C-C chemokine receptor type 7 precursor
  KO
K04182  C-C chemokine receptor type 7
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    287673 (Ccr7)
   04061 Viral protein interaction with cytokine and cytokine receptor
    287673 (Ccr7)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    287673 (Ccr7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    287673 (Ccr7)
   04050 Cytokine receptors [BR:rno04050]
    287673 (Ccr7)
   04090 CD molecules [BR:rno04090]
    287673 (Ccr7)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    287673 (Ccr7)
Cytokine receptors [BR:rno04050]
 Chemokine receptors
  CC Chemokine
   287673 (Ccr7)
CD molecules [BR:rno04090]
 Proteins
  287673 (Ccr7)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx DUF621
Other DBs
NCBI-GeneID: 287673
NCBI-ProteinID: NP_955783
RGD: 735151
Ensembl: ENSRNOG00000010665
UniProt: Q6U2D6
Position
10
AA seq 378 aa
MDLGKPTKNVLVVALLVIFQVCFCQDEVTDDYIGENTTVDYTLYESVCFKKDVRNFKAWF
LPLMYSVICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLMILPFWAYSEAK
SWIFGAYLCKSIFGIYKLSFFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCI
GIWTLAFFLSIPELLYSGLQKNSGEDTWRCSLVSAQVEALIAIQVAQMVVGFVLPMLAMS
FCYLVIIRTLLQARNFERNKAIKVIIAVVVVFVVFQLPYNGVVLAQTVANFNITNSSCEA
SKQLNIAYDVTYSLASVRCCVNPFLYAFIGVKFRSDLFKLFKDLGCLSQERLRQWSSCRH
VRHTSVSMEAETTTTFSP
NT seq 1137 nt   +upstreamnt  +downstreamnt
atggacctggggaagcccacgaaaaacgtgctggtggtggctctcctggtcattttccag
gtgtgcttctgccaagatgaggtcacagacgactacatcggcgagaacaccaccgtggac
tacaccctgtatgagtcggtgtgcttcaagaaggatgtgcggaactttaaggcctggttc
ctccctctcatgtactcagtcatttgcttcgtgggcctgctaggcaatgggctggtggtg
ctgacatacatctatttcaagagactgaagaccatgacggatacctacctgctcaacctg
gccgtggcagacatcctcttcctcatgatccttcccttctgggcctacagcgaagccaag
tcctggatctttggtgcctacctgtgtaagagcatctttggcatctacaagttaagcttc
ttcagcgggatgttgctgctcctgtgtatcagcattgaccgctatgtggccatcgtccag
gccgtgtcagcccaccggcaccgcgcccgcgtgcttctcatcagcaagctgtcctgtata
ggcatctggacgctggcctttttcctttctatccctgagctgctctacagcggcctccag
aagaacagcggcgaggacacgtggagatgctccctggtcagtgcccaagtggaggccttg
atcgccatccaagtggcccagatggttgttgggtttgtactgcctatgctggctatgagt
ttctgctacctggttatcatccgcactctgctccaggcgcgaaacttcgagcggaacaag
gccatcaaggtgatcatcgctgtggtcgtagtgttcgtcgtcttccagctgccctacaat
ggggtggtcctggcccagaccgtggccaatttcaacatcaccaatagcagctgcgaagcc
agcaagcagctcaacattgcctatgacgtcacctacagcctggcctccgtccgctgctgt
gtcaaccctttcttgtatgccttcatcggcgtcaagttccgcagcgacctcttcaagctc
ttcaaggacttgggctgcctcagccaggaacggctccggcagtggtcttcctgccgccat
gtacggcacacgtccgtgagcatggaggcggagactaccaccaccttctccccgtag

KEGG   Rattus norvegicus (rat): 29363
Entry
29363             CDS       T01003                                 

Gene name
Cxcr5
Definition
(RefSeq) C-X-C chemokine receptor type 5
  KO
K04190  C-X-C chemokine receptor type 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    29363 (Cxcr5)
   04061 Viral protein interaction with cytokine and cytokine receptor
    29363 (Cxcr5)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    29363 (Cxcr5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    29363 (Cxcr5)
   04050 Cytokine receptors [BR:rno04050]
    29363 (Cxcr5)
   04090 CD molecules [BR:rno04090]
    29363 (Cxcr5)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    29363 (Cxcr5)
Cytokine receptors [BR:rno04050]
 Chemokine receptors
  CXC Chemokine
   29363 (Cxcr5)
CD molecules [BR:rno04090]
 Proteins
  29363 (Cxcr5)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 29363
NCBI-ProteinID: NP_445755
RGD: 62010
Ensembl: ENSRNOG00000012430
UniProt: P34997
Position
8
AA seq 374 aa
MNSPISLDMGAITYNMDDLYKELAIYSNSTEIPLQDSIFCSTEEGPLLTSFKTIFMPVAY
SLIFLLGMMGNILVLVILERHRHTRSSTETFLFHLAVADLLLVFILPFAVAEGSVGWVLG
TFLCKTVIALHKINFYCSSLLLACIAVDRYLAIVHAVHAYRRRRLLSIHITCSTIWLAGF
LFALPELLFAKVVQPHNNESLPQCIFSQENEAETRAWFASRFLYHTGGFLLPMLVMAWCY
VGVVHRLLQAQRRPQRQKAVRVAILVTSIFLLCWSPYHIVIFLDTLERLKAVNSSCELSG
YLSVAITLCEFLGLAHCCLNPMLYTFAGVKFRSDLSRLLTKLGCAGPASLCQLFPGWRKS
SLSESENATSLTTF
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgaactccccgatatcgctagacatgggcgccatcacctacaacatggacgatctgtac
aaggaactggccatctacagtaacagcacggagatccccctacaggacagtatcttctgt
tctacagaggaggggcccctactgacttcctttaagacgatattcatgcctgtggcctac
agcctcatcttcctcctgggtatgatgggaaacatcctcgtactggtaatcctggagagg
caccggcacactcggagctcaacggagaccttcctgttccacctggcagtagccgacctt
ctcttggtcttcatcttgccttttgcagtggctgagggctctgtgggttgggtcctaggg
accttcctctgcaaaactgtgatcgccctgcacaagatcaatttctactgcagcagcctg
ctgctggcctgcatagctgtcgaccgttatctggccatcgtccatgcggtccacgcctac
cgccgccgccgtctcctctctatccacatcacctgctcgactatttggctagccggcttc
ctatttgccttgccagaactcctctttgccaaggttgtccaacctcataacaacgagtcc
ttaccacagtgcatcttctcccaagaaaatgaagccgaaactagagcctggttcgcctcc
cggtttctctaccacactgggggcttcctgctaccgatgctcgtgatggcctggtgttat
gtgggagtggtacacaggctattgcaggcccagcggcgccctcagaggcagaaggcagtc
agggtggccatcttggtgacaagcatcttccttctctgctggtcaccctaccacattgtc
atcttcctcgatacactggaaaggctgaaggctgtgaacagcagttgcgaattgagtggc
tacctctcagtggctatcaccttatgtgaattcctgggcctggctcactgctgtctcaat
cccatgctctacaccttcgctggcgtaaagttccgcagtgacttgtctcggcttctgacc
aagctgggctgtgctggcccggcctccctttgtcagctctttccgggctggcgcaagagc
agtctctctgagtcagagaacgctacttctcttaccaccttctag

KEGG   Rattus norvegicus (rat): 29385
Entry
29385             CDS       T01003                                 

Gene name
Cxcr2
Definition
(RefSeq) C-X-C chemokine receptor type 2
  KO
K05050  C-X-C chemokine receptor type 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04072  Phospholipase D signaling pathway
rno04144  Endocytosis
rno05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    29385 (Cxcr2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    29385 (Cxcr2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    29385 (Cxcr2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    29385 (Cxcr2)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    29385 (Cxcr2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    29385 (Cxcr2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    29385 (Cxcr2)
   04050 Cytokine receptors [BR:rno04050]
    29385 (Cxcr2)
   04090 CD molecules [BR:rno04090]
    29385 (Cxcr2)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    29385 (Cxcr2)
Cytokine receptors [BR:rno04050]
 Chemokine receptors
  CXC Chemokine
   29385 (Cxcr2)
CD molecules [BR:rno04090]
 Proteins
  29385 (Cxcr2)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 29385
NCBI-ProteinID: NP_058879
RGD: 2906
Ensembl: ENSRNOG00000014269
Vega: OTTRNOG00000001499
UniProt: P35407
Position
9
AA seq 359 aa
MGEIRVDNFSLEDFFSGDIDSYNYSSDPPFTLSDAAPCPSANLDINRYAVVVIYVLVTLL
SLVGNSLVMLVILYNRSTCSVTDVYLLNLAIADLFFALTLPVWAASKVNGWIFGSFLCKV
FSFLQEITFYSSVLLLACISMDRYLAIVHATSTLIQKRHLVKFVCITMWFLSLVLSLPIF
ILRTTVKANPSTVVCYENIGNNTSKWRVVLRILPQTYGFLLPLLIMLFCYGFTLRTLFKA
HMGQKHRAMRVIFAVVLVFLLCWLPYNIVLFTDTLMRTKLIKETCERQNEINKALEATEI
LGFLHSCLNPIIYAFIGQKFRHGLLKIMANYGLVSKEFLAKEGRPSFVGSSSANTSTTL
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgggagaaatcagggtggataatttcagccttgaagacttcttcagtggagatattgac
agttacaattacagttctgacccgccctttactctgtcagatgctgccccatgcccctca
gcgaacctagatatcaacaggtatgctgtggttgtcatatacgttctggtgactttgctg
agtctcgtgggaaactccctggtgatgctggtcatcttgtacaatcgaagcacctgctct
gtcaccgacgtctacctgctgaacctggccattgctgatctgttctttgccctgaccttg
cctgtctgggctgcatctaaagtaaatggatggatttttggctcattcctgtgcaaggta
ttctcgttcctgcaggagattaccttctacagcagtgttctgttgctagcctgcatcagc
atggaccgctacctggccatcgtccacgccacaagtacactgatccagaagagacacttg
gtcaagtttgtgtgcatcaccatgtggtttctctcactagttctgtccctgcccatcttc
attcttcggactactgttaaggcaaacccttctaccgtagtctgctatgagaatataggt
aataatacatccaagtggagggtggtactgcgcatcctgcctcagacctatggcttcctc
ctgccgctgctcatcatgctgttctgctatgggttcacactgcgcacgctctttaaggcc
cacatggggcagaagcaccgggccatgcgggtcatctttgctgtggtcctcgtcttcctg
ctctgctggcttccctacaacattgtcctgttcacagacaccctcatgagaaccaagctg
atcaaggagacctgtgaacgccagaacgagattaacaaagctttggaagctactgagatt
cttggcttcctccacagctgtcttaaccccatcatctatgcctttattggccagaaattt
cgccatggacttctcaagatcatggctaattatggccttgtcagcaaggagttcttagcc
aaggagggcaggccttcttttgttggctcttcttcagcgaacacctccactaccctctaa

KEGG   Rattus norvegicus (rat): 301066
Entry
301066            CDS       T01003                                 

Gene name
Ccr8
Definition
(RefSeq) C-C chemokine receptor type 8
  KO
K04183  C-C chemokine receptor type 8
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    301066 (Ccr8)
   04061 Viral protein interaction with cytokine and cytokine receptor
    301066 (Ccr8)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    301066 (Ccr8)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    301066 (Ccr8)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    301066 (Ccr8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    301066 (Ccr8)
   04050 Cytokine receptors [BR:rno04050]
    301066 (Ccr8)
   04090 CD molecules [BR:rno04090]
    301066 (Ccr8)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    301066 (Ccr8)
Cytokine receptors [BR:rno04050]
 Chemokine receptors
  CC Chemokine
   301066 (Ccr8)
CD molecules [BR:rno04090]
 Proteins
  301066 (Ccr8)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx Abhydrolase_9_N
Other DBs
NCBI-GeneID: 301066
NCBI-ProteinID: XP_008764924
RGD: 1304893
Ensembl: ENSRNOG00000026759
UniProt: D4ADE0
Position
8
AA seq 353 aa
MDYTLEPNVTMTDYYPDFFTTPCDTELLLRGGTLYLAVLYCILFVLGLLGNSLVILVLVA
CKKLRSITDVYLLNLAASDLLFVLSIPFQTHNLLDQWVFGTVMCKVVSGLYYIGFFSSML
FITLMSVDRYLAVVHPVHAIKVRTARVGTALSLAVWLAAIAATVPLMVFYQVSSEDGMLQ
CFQLYDEQSLRWKLFTHFEVNALGLLLPFAILLFCYVRILQQLRGCLNHNRTRAIKLVLT
IVVVSLLFWVPFNVVLFLTSLHDMHILEGCATRQRLALATHVTEVISFMHCCVNPVIYAF
IGEKFKKHLVDVFQKSCSHIFLYVGRQMPVGALERQLSSNQRSSHSSTLDYIL
NT seq 1062 nt   +upstreamnt  +downstreamnt
atggattacacgttggagcccaatgtcacgatgactgactactaccctgacttcttcacc
accccctgtgacacagagctcctcctcaggggtggcacgttgtatctggccgtcttatac
tgcatcttgtttgtgctgggccttctgggaaacagcctggtcatcttggtccttgtggcc
tgcaagaaactgaggagtatcacggacgtctacctcctgaacctggccgcttctgacctg
ctcttcgtcctctccattccctttcagacccacaacctgctggaccagtgggtgtttggg
accgtgatgtgtaaggtggtctctggcctctactacattggcttcttcagcagcatgctc
ttcatcaccctcatgagtgtggacaggtacctggctgtcgtccaccctgtccatgccatc
aaagtgaggacggccagagtgggcacagccctgagcctggcagtgtggctggctgccatc
gcggccaccgtcccactgatggttttttaccaggtgtcctctgaagacggcatgctacag
tgcttccaactttacgacgagcagtctctgaggtggaagctcttcacccactttgaagtc
aacgccttgggtctgctgctcccctttgccatcctcctgttctgctacgtcaggatcctg
cagcagctgcggggttgcctgaaccacaacaggaccagagccatcaaactggtgctcacc
atagtcgtcgtgtctttactcttctgggtcccattcaacgtggtcctcttcctcacgtcc
ctgcacgacatgcacatcttggagggatgtgccaccaggcagaggctggccctggccacc
cacgtcacggaggtcatctctttcatgcattgctgcgtgaaccctgtcatctatgctttc
atcggagagaagttcaagaagcacctcgtggatgtgtttcaaaagagctgcagccacatc
ttcctctacgtcgggagacagatgccagtgggggcgttggaaaggcaactgtcctcgaac
cagcgatcttcccactcttccacactggactacatcttgtaa

KEGG   Rattus norvegicus (rat): 301086
Entry
301086            CDS       T01003                                 

Gene name
Xcr1
Definition
(RefSeq) chemokine XC receptor 1
  KO
K04193  XC chemokine receptor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    301086 (Xcr1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    301086 (Xcr1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    301086 (Xcr1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    301086 (Xcr1)
   04050 Cytokine receptors [BR:rno04050]
    301086 (Xcr1)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Chemokine
   C Chemokine
    301086 (Xcr1)
Cytokine receptors [BR:rno04050]
 Chemokine receptors
  C Chemokine
   301086 (Xcr1)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 301086
NCBI-ProteinID: NP_001100341
RGD: 1311480
Ensembl: ENSRNOG00000006620
UniProt: D3ZGG9
Position
8
AA seq 338 aa
MDSDSDALSIPASWVQMESSTVFDYDKSNLLCDNNVIFFSIIFTIVLYSLVFLLSLVGNS
LVLWVLVKYENLESLTNVFILNLCLSDLMFSCLLPVLISAQWGWFLGDFFCKFINMIFCI
SLYSSIFFLTIMTIHRYMSVVSPISSLGIYTLRCRMLVTTSVWAASILFSIPDTVFHKVI
SLKCDFSERHGLLASVYQHNILFLLSMGIILFCYVQILRTLFRSRSRQRHRTVRLIFTIV
VAYFLSWAPYNLVLFLKTEVIQLSCEGRQQLDFAMIICRNLAFSHCCFNPVLYVFVGVKF
RRHLKRLLQQVWLCPKTSNPVPFSYSPGTFTYEGPSFY
NT seq 1017 nt   +upstreamnt  +downstreamnt
atggactcagactcagatgctctcagtatacctgcctcctgggtccagatggagtcctct
acagtctttgattatgataaatcgaatcttctatgtgacaacaatgtcatcttcttttcc
atcatcttcaccattgtcctgtactctctggtatttctcctcagcctggtgggtaacagc
ctggttttgtgggtcttggtgaagtatgagaatctagagtcactcaccaatgtcttcatc
ctcaacctgtgtctctcagacctcatgttctcctgcctactgcccgtgttgatctcagca
caatgggggtggtttctaggcgacttcttctgcaagttcatcaacatgatcttctgcatc
agcctctacagcagcatcttcttccttaccatcatgacaatccaccgatacatgtctgta
gtgagccccatctcctctctgggcatctataccctccgctgccgcatgctggtgaccaca
tctgtgtgggcagccagtatcctgttctccatccctgatactgtcttccacaaagtgatt
tccttaaaatgtgacttttctgaacgtcatgggttgttggcatcagtctaccagcacaac
atcctcttcctcctctccatggggataatcttgttctgctatgtacagattctcaggacc
ttgtttcgctcaaggtccagacagagacaccgaacggtcaggctcatcttcaccatcgtg
gtagcatacttcctcagctgggctccttacaacctcgttctcttcctgaaaactgaagtc
atccagctgagctgtgagggaagacagcagctggactttgctatgatcatctgtcgcaat
ttggccttctcccactgctgcttcaatccagtgctttatgtctttgttggggtcaagttc
cgcagacacctaaaacgtctcctccagcaggtctggctgtgcccaaagacatccaatcct
gttccattctcctactcccctggtacctttacatatgagggcccctccttctactga

KEGG   Rattus norvegicus (rat): 301088
Entry
301088            CDS       T01003                                 

Gene name
Ccr1l1
Definition
(RefSeq) C-C chemokine receptor 1-like protein 1
  KO
K04176  C-C chemokine receptor type 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno05163  Human cytomegalovirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    301088 (Ccr1l1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    301088 (Ccr1l1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    301088 (Ccr1l1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    301088 (Ccr1l1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    301088 (Ccr1l1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    301088 (Ccr1l1)
   04050 Cytokine receptors [BR:rno04050]
    301088 (Ccr1l1)
   04090 CD molecules [BR:rno04090]
    301088 (Ccr1l1)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    301088 (Ccr1l1)
Cytokine receptors [BR:rno04050]
 Chemokine receptors
  CC Chemokine
   301088 (Ccr1l1)
CD molecules [BR:rno04090]
 Proteins
  301088 (Ccr1l1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 301088
NCBI-ProteinID: NP_001100342
RGD: 1308007
Ensembl: ENSRNOG00000006730
UniProt: D3ZFW8
Position
8
AA seq 356 aa
MESPAVTESSYNTVAMNDFFSGFVCFSINVRAFGITVLTPLYSLVFVIGVIGNVLVVLVL
IQRKRLRNMTSIYLFNLAVSDLVFLFTLPFWVDYIVKGDWVFGNAMCKFLAGFYYLGLYS
DMFFITLLTIDRYLAVVHAVFALRARTVTFGIISSIITWVLATLVSIPCLYFFKTQLEFT
YQTCRAVLPKKSLIQFLRFQALTMNILGLILPLLAMIICYTRIINVLHRRPNKKKAKVMR
LIFVITLLFFLLLTPYYLAAFVSAFEDVLFTPGCVRSQQVDLALMITEALAYTHCCVNPV
IYVFVGERFRKYLRQLFWRRTAVSLPKWLPFHSVDRVQRSSSTSPSTGEIEVSADL
NT seq 1071 nt   +upstreamnt  +downstreamnt
atggagagtccagctgtcacagagtcctcctataacacagttgccatgaatgacttcttt
tctggattcgtatgtttcagcataaatgtgcgggcatttggaatcacagtgctgactccg
ctgtactcgctggtgtttgtcattggtgtgataggcaatgtcctggtggttctggtgctc
atacaacgcaagaggcttcgaaacatgaccagcatctacctgttcaacctggctgtctct
gatctggtctttctattcacactacctttctgggttgactatatcgtaaaaggagactgg
gtgtttggtaatgccatgtgtaagtttctcgctggattttattacctgggcttgtatagt
gacatgttttttatcaccctgcttacaattgataggtacctagctgttgtccatgctgtg
tttgctctgagggcccggactgtcacttttggcatcatcagcagcatcattacctgggtc
ctagctaccttggtttctattccttgtctgtattttttcaaaactcagttggagttcact
taccaaacctgcagagcagttttgcccaagaagagcctgatacagtttttgaggtttcag
gctctcacaatgaacatccttgggctaattttgcctctgttggccatgatcatctgctat
acaaggatcatcaatgttctacacagaagacccaataagaagaaggccaaagtcatgcgt
ctgatttttgttattacacttctcttcttcctcctcttgaccccctattatttggctgcc
tttgtttctgcttttgaagacgtcctattcacccccgggtgtgtgagaagccaacaggtg
gacctggccttgatgataactgaggcacttgcctacacccactgctgtgtcaacccagtc
atttatgtctttgtgggtgaacggttccggaagtacctccggcagctgttttggaggcgt
acagctgtatccctgccaaaatggctgcccttccactcggtagaccgagtacagaggtcc
agttccacgtctccatccacaggggaaattgaggtctctgctgacttataa

KEGG   Rattus norvegicus (rat): 308163
Entry
308163            CDS       T01003                                 

Gene name
Ccr6
Definition
(RefSeq) C-C chemokine receptor type 6
  KO
K04181  C-C chemokine receptor type 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    308163 (Ccr6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    308163 (Ccr6)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    308163 (Ccr6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    308163 (Ccr6)
   04050 Cytokine receptors [BR:rno04050]
    308163 (Ccr6)
   04090 CD molecules [BR:rno04090]
    308163 (Ccr6)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    308163 (Ccr6)
Cytokine receptors [BR:rno04050]
 Chemokine receptors
  CC Chemokine
   308163 (Ccr6)
CD molecules [BR:rno04090]
 Proteins
  308163 (Ccr6)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 308163
NCBI-ProteinID: NP_001013163
RGD: 1308562
Ensembl: ENSRNOG00000012964
UniProt: Q5BK58
Position
1
AA seq 366 aa
MNFTEANYGMEDYTGSDYSMFPETEPCSLQEVRDFTKVFVPIAYSLICVFGLLGNIMVVI
TFAFYKKARSMTDVYLLNMAITDILFVLTLPFWAVTHATDTWIFGNTMCKLMKGTYAVNF
NCGMLLLACISMDRYIAIVQATKSFRVRSRTLTHSKVICLTVWFVSIIISSPTFFFNKQY
KLQGRDVCEPQYKLVSEPITWKLLGMGLELLFGFFIPLLFMVFCYLFIIKTLVQAQNSKR
HRAIRVVIAVVLVFLACQIPHNMVLLVTAANTGKMGRSCSAEKALAYARNVAEVLAFLHC
CLNPVLYAFIGQKFRSYFMKIMKDVWCMRRKSKVPTFFCARVYSESYISRQTSETVENDN
ASSFTM
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgaatttcaccgaggccaactacggaatggaagattatactggctcagattactctatg
tttccagagaccgagccatgctctctgcaagaggtcagagacttcaccaaggtgttcgtg
ccaatcgcctactccttaatctgtgtctttggcctccttggcaatattatggtggtgata
acctttgccttctacaagaaagccaggtccatgactgacgtctacctattgaacatggcc
atcacagacatactctttgtcctcaccctaccattctgggcagttactcatgccactgac
acttggatctttggcaacacgatgtgtaaactgatgaaaggcacgtatgcggtcaacttt
aactgtgggatgctgctcctggcctgtatcagcatggaccggtacattgccatcgtccag
gcgaccaaatctttccgggtacgctccagaacactgacgcacagtaaggtcatctgtctg
acggtgtggttcgtttccatcatcatctcaagccccacattcttcttcaacaagcaatac
aagctgcagggccgtgatgtctgcgagcctcagtacaagctcgtctcggagcccatcacg
tggaaactgctgggcatgggactcgagctgctctttggcttcttcatccctttgctgttt
atggtgttctgttacctgttcatcatcaagaccttggtgcaggcccagaattccaagagg
cacagagccatccgagtcgtgattgctgtggttctcgtgttcctggcttgtcagatccct
cacaacatggtcctcctcgtgactgcagccaacacgggcaaaatgggccgcagctgcagc
gccgagaaagccctcgcctacgccaggaatgtggctgaggtcctggctttcctgcactgc
tgtctcaaccccgtgttgtatgccttcattggacagaaattcagaagctacttcatgaag
atcatgaaggatgtgtggtgtatgaggaggaagagcaaggtgcctaccttcttctgtgcc
cgggtttactcagaaagctacatctccaggcagaccagtgagactgtagaaaatgacaac
gcatcgtcctttaccatgtaa

KEGG   Rattus norvegicus (rat): 363682
Entry
363682            CDS       T01003                                 

Gene name
Ccr10
Definition
(RefSeq) C-C chemokine receptor type 10
  KO
K04185  C-C chemokine receptor type 10
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    363682 (Ccr10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    363682 (Ccr10)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    363682 (Ccr10)
   04062 Chemokine signaling pathway
    363682 (Ccr10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    363682 (Ccr10)
   04050 Cytokine receptors [BR:rno04050]
    363682 (Ccr10)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    363682 (Ccr10)
Cytokine receptors [BR:rno04050]
 Chemokine receptors
  CC Chemokine
   363682 (Ccr10)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 363682
NCBI-ProteinID: NP_001102306
RGD: 1310716
Ensembl: ENSRNOG00000020275
UniProt: D3ZJH1
Position
10
AA seq 362 aa
MGTKPTEQVSWGPYSGYEEEAYSAGPLPELCYKADVQAFSRAFQPSVSLMVAVLGLVGNG
LVLATHLAARRTTRSPTSVHLLQLALADLLLALTLPFAAAGALQGWNLGSTTCRAISGLY
SASFHAGFLFLACISADRYVAITRALPAGQRPSTPSRAHLVSVFVWLLSLLLALPALLFS
RDGPREGQRRCRLLFPESLTQTVKGASAVAQVVLGFALPLGVMAACYALLGRTLLAARGP
ERRRALRVVVALVVAFVVLQLPYSLALLLDTADLLAARERSCSSSKRKDLALLVTGGLTL
VRCSLNPVLYAFLGLRFRQDLRRLLQGGGCSPKPNPRGRCPRRLRLSSCSAPTETHSVSW
DN
NT seq 1089 nt   +upstreamnt  +downstreamnt
atggggaccaagcccacagaacaggtctcctggggaccttactccgggtatgaggaggag
gcttattcagctgggccgctgccggagctctgttacaaggccgatgtccaggcttttagt
cgggccttccaacccagtgtctccctgatggtggctgtgctgggtttggtgggcaatggc
ttagtcttggccacccatctggcagcccgccgaactacccgatctcccacctccgttcac
ctgctccagttggccctggctgacctcttattggccctgaccttgccttttgctgcagca
ggggctcttcagggctggaatttaggaagtaccacctgccgtgccatctcaggcctctac
tcggcctccttccacgcaggcttcctcttcctagcctgcatcagcgccgaccgctatgtg
gccatcacaagagctctcccagcagggcagcggccctccacgcctagccgtgcccacttg
gtctcagtcttcgtgtggctgttgtcgctgcttctggctctacctgcgctccttttcagc
cgggacgggccacgggaaggccaacgacgctgtcggctcctttttcccgaaagcctcacg
cagactgtgaaaggggcaagcgccgtggcgcaggtggtcctcggcttcgcgctgcctctg
ggtgtcatggcagcctgttatgcgctcctgggccgcacgcttctggccgccagggggcca
gagcggcggcgtgcactgcgcgtcgtggtggccttggtggtggccttcgtggtgctgcag
ttgccctacagcctcgccctgctgctggatacagccgatctactggcagcccgtgagcgg
agctgctcctccagcaagcgcaaggatttagctctgctggtcaccggaggcttgacctta
gtccgctgcagcctcaatccggtgctgtatgcttttttgggcctgcgcttccgccaggac
ctgaggaggctgctacagggcggaggatgcagcccgaagcccaaccctcgtggccgctgc
ccccgccgactccgcctttcttcctgctccgctcctactgagacccacagtgtctcttgg
gacaactag

KEGG   Rattus norvegicus (rat): 54258
Entry
54258             CDS       T01003                                 

Gene name
Cxcr1
Definition
(RefSeq) C-X-C chemokine receptor type 1
  KO
K04175  C-X-C chemokine receptor type 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04072  Phospholipase D signaling pathway
rno04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    54258 (Cxcr1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    54258 (Cxcr1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    54258 (Cxcr1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    54258 (Cxcr1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    54258 (Cxcr1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    54258 (Cxcr1)
   04050 Cytokine receptors [BR:rno04050]
    54258 (Cxcr1)
   04090 CD molecules [BR:rno04090]
    54258 (Cxcr1)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    54258 (Cxcr1)
Cytokine receptors [BR:rno04050]
 Chemokine receptors
  CXC Chemokine
   54258 (Cxcr1)
CD molecules [BR:rno04090]
 Proteins
  54258 (Cxcr1)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 54258
NCBI-ProteinID: NP_062183
RGD: 2905
Ensembl: ENSRNOG00000048239
Vega: OTTRNOG00000001500
UniProt: P70612
Position
9
AA seq 349 aa
MAEAEYFIWIAPEGDFEEEFGNITRMLPTGEYFSPCKRVPMTNRQAVVVFYALVFLLSLL
GNSLVMLVILYRRRTRSVTDVYVLNLAIADLLFSLTLPFLAVSKWKGWIFGTPLCKMVSL
LKEVNFFSGILLLACISVDRYLAIVHATRTLTRKRYLVKFVCMGTWGLSLVLSLPFAIFR
QAYKPYRSGTVCYEVLGEATADLRITLRGLSHIFGFLLPLFIMLVCYGLTLRTLFKAHMR
QKRRAMWVIFAVVLVFLLCCLPYNLVLLSDTLLGAHLIQDTCERRNNIDQALYITEILGF
SHSCLNPVIYAFVGQSFRHEFLKILANLVHKEVLTHHSASFRTSLTTIY
NT seq 1050 nt   +upstreamnt  +downstreamnt
atggccgaggctgagtatttcatctggattgctcctgagggtgactttgaggaagaattt
ggaaatatcacccgaatgctgcccactggagagtatttcagcccctgtaagagggttcca
atgaccaacaggcaggctgtagttgtcttctatgcactggtgttccttcttagcttgctg
ggaaactcgctggtgatgctggtcatcttatacaggcgaaggacccgatccgtcaccgat
gtctacgtgctgaacctagccattgctgatctactcttttcattgactctgcccttcttg
gctgtctccaaatggaagggctggatttttggcacacccctgtgcaagatggtctcactc
ctgaaggaagtcaacttcttcagtggtatcttgctgctggcctgcatcagtgtggatcga
tacctggccatcgtccatgccacccgcacactgacccgaaagcgctacttggttaaattc
gtatgcatgggcacctggggtctatccttggttctgtctctgccttttgccatcttccgc
caggcatataaaccataccgttctggaacagtctgctatgaggtcctgggtgaagccaca
gcagatcttaggataacattgcgtggtctgtcccacatatttggcttcctcttgccgctg
ttcatcatgctggtctgctacgggctcacactgcgcacgctctttaaggcccacatgaga
cagaaacgccgggccatgtgggtgatctttgctgttgtgttggtcttcctgctctgttgt
ctgccctacaatctggttctgctctcggacactctcttaggagcccacttgattcaagat
acttgcgagcgccgcaataacattgaccaggccttgtatattaccgagatcctgggcttt
tctcacagttgtcttaaccccgtcatctatgcctttgttggccaaagttttcgccatgaa
ttcctcaagatccttgctaacctggttcacaaggaggttttgacacaccactctgcttcc
tttcgcacgtctctcaccactatctattaa

KEGG   Rattus norvegicus (rat): 57301
Entry
57301             CDS       T01003                                 

Gene name
Ccr1
Definition
(RefSeq) C-C chemokine receptor type 1
  KO
K04176  C-C chemokine receptor type 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno05163  Human cytomegalovirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    57301 (Ccr1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    57301 (Ccr1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    57301 (Ccr1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    57301 (Ccr1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    57301 (Ccr1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    57301 (Ccr1)
   04050 Cytokine receptors [BR:rno04050]
    57301 (Ccr1)
   04090 CD molecules [BR:rno04090]
    57301 (Ccr1)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    57301 (Ccr1)
Cytokine receptors [BR:rno04050]
 Chemokine receptors
  CC Chemokine
   57301 (Ccr1)
CD molecules [BR:rno04090]
 Proteins
  57301 (Ccr1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srw DUF1240 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 57301
NCBI-ProteinID: NP_065417
RGD: 708446
Ensembl: ENSRNOG00000006715
UniProt: Q9JLY8
Position
8
AA seq 355 aa
MEISNITETYPTTTEYDYGDSTPCQKTDVRAFGAGLLPPLYSFVFIIGVVGNILVILVLM
QHRRLQSMTSIYLFNLAVSDLVFLFTLPFWIDYKLKDNWVFGDAMCKLLSGFYYLGLYSE
IFFIILLTIDRYLAIVHAVFSLRARTVTFGIITSIIIWALAILASIPALCFFKAQWEFTH
HTCSPHFPDESLKTWKRFQALKLNLLGLILPLLVMIICYAGIIRILLRRPNEKKAKAVRL
IFAITLLFFLLWTPYNLTVFVSAFQDVLFTNQCEQSKQLDLAIQVTEVIAYTHCCVNPII
YVFVGERFRKYLRQLFQRHVAIPLAKWLPFFSVDQLERTSSLTPSTGEHELSGGF
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggagatttcaaatatcacagaaacctaccccacaaccacagaatatgactatggggac
tctactccatgccaaaaaactgatgtaagagccttcggggctggactcctgccccccctg
tactctttcgtgtttatcattggagtggtaggcaatatcctggtgattctggtgctcatg
cagcataggaggcttcaaagcatgaccagcatatacctgttcaacctggctgtctctgat
ctggtcttccttttcactttacctttctggattgactacaagctgaaagacaactgggtt
tttggtgatgccatgtgtaagcttctctctgggttttattacctgggcttatacagtgag
atcttctttatcatcctgctgacaattgacaggtacctggccattgtccatgcagtgttt
tccctgagggcccgaactgtcacttttggcatcatcaccagtattattatttgggcccta
gccatcttagcttctattcctgccttatgctttttcaaggcccagtgggagttcactcac
catacctgtagccctcatttccccgatgagagcctgaagacgtggaagaggtttcaggct
ctaaagctaaacctccttggactaattttacctctgttagtcatgataatttgctacgca
gggatcatcagaattctgctcagacgacccaatgagaagaaggccaaagccgtgcgtctg
atatttgctattacgcttctattcttcctcctctggaccccctacaatctgactgtattt
gtttctgctttccaagatgttctattcaccaatcagtgtgagcagagcaagcagctggac
ctggccatacaggtgactgaagtgattgcctacacccactgttgtgtcaatccaatcatt
tatgtctttgtgggtgagcggttccggaagtaccttcggcagctgtttcaaaggcatgtg
gctataccgctggcaaaatggctgcccttcttctctgtggaccaactagaaaggaccagt
tccttaactccatccacaggagaacatgaactttctgggggcttctga

KEGG   Rattus norvegicus (rat): 60463
Entry
60463             CDS       T01003                                 

Gene name
Ccr2
Definition
(RefSeq) C-C chemokine receptor type 2
  KO
K04177  C-C chemokine receptor type 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    60463 (Ccr2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    60463 (Ccr2)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    60463 (Ccr2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    60463 (Ccr2)
   04050 Cytokine receptors [BR:rno04050]
    60463 (Ccr2)
   04090 CD molecules [BR:rno04090]
    60463 (Ccr2)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    60463 (Ccr2)
Cytokine receptors [BR:rno04050]
 Chemokine receptors
  CC Chemokine
   60463 (Ccr2)
CD molecules [BR:rno04090]
 Proteins
  60463 (Ccr2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx DUF1467 7TM_GPCR_Srab
Other DBs
NCBI-GeneID: 60463
NCBI-ProteinID: NP_068638
RGD: 620876
UniProt: O55193
Position
8
AA seq 373 aa
MEDSNMLPQFIHGILSTSHSLFPRSIQELDEGATTPYDYDDGEPCHKTSVKQIGAWILPP
LYSLVFIFGFVGNMLVIIILISCKKLKSMTDIYLFNLAISDLLFLLTLPFWAHYAANEWV
FGNIMCKLFTGLYHIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVITSVVTWVV
AVFASLPGIIFTKSEQEDDQHTCGPYFPTIWKNFQTIMRNILSLILPLLVMVICYSGILH
TLFRCRNEKKRHRAVRLIFAIMIVYFLFWTPYNIVLFLTTFQEFLGMSNCVVDMHLDQAM
QVTETLGMTHCCVNPIIYAFVGEKFRRYLSIFFRKHIAKNLCKQCPVFYRETADRVSSTF
TPSTGEQEVSVGL
NT seq 1122 nt   +upstreamnt  +downstreamnt
atggaagacagtaatatgttacctcagttcatccatggcatactatcaacatctcattct
ctatttccaagaagtatccaagagcttgatgagggggccaccacaccgtatgactatgat
gatggtgaaccttgtcataaaaccagtgtgaagcaaattggagcttggatcctgccccca
ctctactccctggtattcatctttggttttgtgggcaacatgttggtcattataattctg
ataagctgtaaaaagctgaagagcatgactgatatctacctgttcaacctggccatctct
gacctgctcttcctgctcacactcccattctgggctcactatgctgcaaatgagtgggtc
tttgggaatataatgtgcaaattattcacagggctttatcacattgggtattttggtgga
atcttcttcattatcctcctgacaattgatagatatttggctattgtccatgctgtcttt
gctttaaaagccaggacagttacctttggggtaataacaagtgtagtcacttgggtggtg
gctgtgtttgcctctctaccaggaatcatatttactaaatctgaacaagaagatgatcag
catacttgtggcccttattttccaacaatctggaagaatttccaaacaataatgaggaat
atcttgagtttgatcctgcccctacttgtcatggtcatctgctactcaggaatcctccac
accctgtttcgctgtaggaatgagaaaaagaggcatagggctgtgaggctcatctttgcc
atcatgattgtctactttctcttctggactccatacaatattgttctcttcctgaccacc
ttccaggaattcttgggaatgagtaactgtgtggttgacatgcacttagaccaggccatg
caggtgacagagactcttggaatgacacactgctgcgttaatcctatcatttatgccttt
gttggtgagaagttccgaaggtatctctccatatttttcagaaagcacattgccaaaaat
ctctgcaaacaatgcccagttttctatagggagacagcagaccgagtgagctcaacattt
accccttctactggggagcaagaagtctcagttgggttgtaa

KEGG   Rattus norvegicus (rat): 60628
Entry
60628             CDS       T01003                                 

Gene name
Cxcr4
Definition
(RefSeq) C-X-C chemokine receptor type 4
  KO
K04189  C-X-C chemokine receptor type 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04144  Endocytosis
rno04360  Axon guidance
rno04670  Leukocyte transendothelial migration
rno04672  Intestinal immune network for IgA production
rno04810  Regulation of actin cytoskeleton
rno05163  Human cytomegalovirus infection
rno05170  Human immunodeficiency virus 1 infection
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    60628 (Cxcr4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    60628 (Cxcr4)
   04061 Viral protein interaction with cytokine and cytokine receptor
    60628 (Cxcr4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    60628 (Cxcr4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    60628 (Cxcr4)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    60628 (Cxcr4)
   04672 Intestinal immune network for IgA production
    60628 (Cxcr4)
   04062 Chemokine signaling pathway
    60628 (Cxcr4)
  09158 Development and regeneration
   04360 Axon guidance
    60628 (Cxcr4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    60628 (Cxcr4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    60628 (Cxcr4)
   05163 Human cytomegalovirus infection
    60628 (Cxcr4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    60628 (Cxcr4)
   04050 Cytokine receptors [BR:rno04050]
    60628 (Cxcr4)
   04090 CD molecules [BR:rno04090]
    60628 (Cxcr4)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    60628 (Cxcr4)
Cytokine receptors [BR:rno04050]
 Chemokine receptors
  CXC Chemokine
   60628 (Cxcr4)
CD molecules [BR:rno04090]
 Proteins
  60628 (Cxcr4)
SSDB
Motif
Pfam: 7tm_1 CXCR4_N 7TM_GPCR_Srsx Cybc1_Eros COX2_TM
Other DBs
NCBI-GeneID: 60628
NCBI-ProteinID: NP_071541
RGD: 620465
Ensembl: ENSRNOG00000003866
UniProt: O08565
Position
13
AA seq 349 aa
MEIYTSDNYSEEVGSGDYDSNKEPCFRDENENFNRIFLPTIYFIIFLTGIVGNGLVILVM
GYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAMADWYFGKFLCKAVHIIYTVNLYSS
VLILAFISLDRYLAIVHATNSQRPRKLLAEKAVYVGVWIPALLLTIPDIIFADVSQGDGR
YICDRLYPDSLWMVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKTTVI
LILAFFACWLPYYVGISIDSFILLEVIKQGCEFESVVHKWISITEALAFFHCCLNPILYA
FLGAKFKSSAQHALNSMSRGSSLKILSKGKRGGHSSVSTESESSSFHSS
NT seq 1050 nt   +upstreamnt  +downstreamnt
atggaaatatacacttcggataactactccgaagaagtagggtctggagactatgactcc
aacaaggaaccctgcttccgggatgaaaacgaaaacttcaacaggatcttcctgcccacc
atctattttatcatcttcttgactggcatagtgggcaatgggttggtaatcctggtcatg
ggttaccagaagaagctgaggagcatgacagacaagtaccggctgcacctgtccgtggct
gacctcctctttgtcatcacactccccttctgggcagtggacgccatggctgactggtac
tttgggaaatttttatgtaaggctgtgcatatcatctacaccgtcaacctttacagcagt
gttctcatcctggccttcatcagcctggaccgctaccttgccattgtccacgccaccaac
agccagaggccgaggaagctgctggctgaaaaggccgtctatgtgggtgtctggatcccc
gccctcctcctgactatccctgacatcatcttcgccgatgtcagccagggggacggcagg
tacatctgtgaccgcctttaccccgacagcctgtggatggtggtgttccagttccagcac
atcatggtgggtctcatcctgccgggcatcgtcatcctgtcctgttactgcatcatcatc
tccaagctgtcacactccaagggccaccagaagcgcaaggccctcaagactacggtcatc
cttatcctggctttctttgcctgctggctaccgtattacgtggggatcagcatcgattcc
ttcatccttttggaggtcatcaagcaaggatgtgagttcgagagcgtcgtgcacaagtgg
atctccatcacggaggccctcgccttcttccactgttgcctgaaccccatcctctacgcc
ttcctcggggccaaattcaagagctccgcgcagcatgcactcaattccatgagcagaggc
tccagcctcaagatcctttccaaagggaaacggggtggacactcttccgtctccacagag
tcagaatcctcaagttttcactccagctaa

KEGG   Rattus norvegicus (rat): 84475
Entry
84475             CDS       T01003                                 

Gene name
Cxcr3
Definition
(RefSeq) C-X-C chemokine receptor type 3
  KO
K04188  C-X-C chemokine receptor type 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    84475 (Cxcr3)
   04061 Viral protein interaction with cytokine and cytokine receptor
    84475 (Cxcr3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    84475 (Cxcr3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    84475 (Cxcr3)
   04050 Cytokine receptors [BR:rno04050]
    84475 (Cxcr3)
   04090 CD molecules [BR:rno04090]
    84475 (Cxcr3)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    84475 (Cxcr3)
Cytokine receptors [BR:rno04050]
 Chemokine receptors
  CXC Chemokine
   84475 (Cxcr3)
CD molecules [BR:rno04090]
 Proteins
  84475 (Cxcr3)
SSDB
Motif
Pfam: 7tm_1 Ctr
Other DBs
NCBI-GeneID: 84475
NCBI-ProteinID: NP_445867
RGD: 621528
Ensembl: ENSRNOG00000003305
Vega: OTTRNOG00000000648
UniProt: Q9JII9
Position
X
AA seq 367 aa
MYLEVSERQVLDASDIAFLLENSTSPYDYGENESDFSDSPPCPQDFSLNFDRTFLPVLYS
LLFLLGLLGNGAVAAVLLSQRTALSSTDTFLLHLAVADVLLVLTLPLWAVDAAAQWVFGS
GLCKVAGALFNINFYAGAFLLACISFDRYLSIVHATQIYRRDPWVRVALTCIVVWGLCVL
FALPDFIFLSASHDQRLNATHCQYNFPQVGRTALRVLQLVAGFLMPLLVMAYCYAHILAV
LLVSRGQRRFRAMRLVVVVVVAFAVCWTPYHLVVLVDILMDVGVLARNCGRESHVDVAKS
VTSGMGYMHCCLNPLLYAFVGVKFKEQMWMLLMRLGRSDQRGPQRQPSSSRRESSWSETT
EASYLGL
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgtaccttgaggtcagtgaacgtcaagtgctagatgcctcggacattgcctttcttctg
gaaaacagcacatctccctacgattatggggaaaacgaaagcgacttctctgactccccg
ccctgcccacaggacttcagcctgaactttgacagaaccttcctgccagtcctctacagc
ctcctctttttgctggggctgctaggcaatggggcagtggctgctgtgctactgagccag
cgcactgccctgagcagcacagacaccttcctgctccacctggctgtggccgatgtactg
ctggtactaaccctcccactgtgggcagtagatgctgctgcccagtgggttttcggctct
ggtctctgcaaagtggcaggtgccctgttcaacatcaacttctacgcaggggccttcctg
ctggcctgtataagctttgaccgctacctgagcatagtgcatgccacccagatctaccgc
agggacccctgggtacgtgtagccctcacctgcattgttgtgtggggtctctgtgtgctc
tttgccctcccagatttcatcttcctgtcagccagccatgatcagcgcctcaatgccacc
cattgccagtacaacttcccacaggtgggtcggactgctctgcgtgtactgcagctagtg
gctggtttcctgatgccccttctagtcatggcctactgctatgcccatatcctggctgtg
ctgctggtctccagaggccagaggcgctttcgagctatgaggctagtggtggtggtggtg
gtggcctttgccgtctgctggaccccctatcacctggtggtgttagtggatatccttatg
gacgtgggagttttggcccgcaactgtggtcgagaaagccatgtggacgtagccaagtca
gtcacctcaggcatgggctacatgcactgctgcctcaatccactgctctatgcctttgtg
ggagtgaagttcaaagaacaaatgtggatgttgctcatgcgcctgggccgctctgaccag
agaggaccgcagcggcagccttcatcttcacggagagaatcatcctggtctgagacaact
gaggcctcctacttgggcttgtaa

DBGET integrated database retrieval system