KEGG   Rattus norvegicus (rat): 100125367Help
Entry
100125367         CDS       T01003                                 

Gene name
C1orf74
Definition
(RefSeq) hypothetical protein LOC100125367
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4504
Motif
Other DBs
NCBI-GeneID: 100125367
NCBI-ProteinID: NP_001096827
RGD: 1642423
Ensembl: ENSRNOG00000005558
UniProt: Q5U2R2
Position
13q27
AA seq 263 aa AA seqDB search
MSTPSPQLLVAAAQRTLGMGKRKCPPRATCLHLAGEVLAVARGLKPAVLYDCNSAGVLAL
QSYLEELQGLGFLKPGLHILEIGENNLIVSPEYTCQHLEQTLLGTVAFVDVSCSQPHPSV
LSLDQLPGLKSLIADIITRFQELLKGVSPGVSYSKLHSSDWNLCTLFGILLGYPVSYTFD
LNHGEGNCLTMTPLRVFTAQISWLSGQPPVPLYSFSVPESLFPPLRNFLSAWEKELRTRF
RAQNAFADLSISSEVVTLPAVAL
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacaccaagccctcagctgctggtggcagctgctcagcggactctgggcatgggg
aagagaaaatgcccacctcgagctacctgccttcacctagcaggagaggtgctggctgtg
gcccgtgggctgaagccagctgtactctatgactgcaactctgcaggggtattggcgctc
cagagctatctggaggaactacaggggctgggcttcctgaagccaggacttcacattctt
gagattggagagaataatctcatcgtcagtcctgagtatacctgtcagcatttggaacag
acactgcttggtactgtagctttcgtggatgtttcctgctcccagcctcatccttctgtc
ctgtcattggaccagctcccgggcttgaaatctctcatagctgacatcatcacacgtttt
caagaactgctgaagggtgtgtctcctggagtctcctacagcaagctacattcctcagac
tggaatctctgcactttatttggaatactcctgggctatcccgtctcttacacatttgac
ctgaaccatggagaaggcaactgcttaaccatgactcccctgagggtgtttactgctcag
atttcatggctgtctggtcaacctccagtcccactgtactcctttagtgttccagagagt
ttgttcccacccctgaggaattttctaagtgcctgggagaaggaactcagaacccgattt
agggctcagaatgcctttgctgacctcagcatttcctccgaggtggtcacacttcctgct
gtggccctctga

DBGET integrated database retrieval system