KEGG   Rattus norvegicus (rat): 100134871
Entry
100134871         CDS       T01003                                 

Definition
(RefSeq) beta globin minor gene
  KO
K13823  hemoglobin subunit beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05143  African trypanosomiasis
rno05144  Malaria
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    100134871
   05143 African trypanosomiasis
    100134871
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    100134871
Membrane trafficking [BR:rno04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    100134871
SSDB
Motif
Pfam: Globin
Other DBs
NCBI-GeneID: 100134871
NCBI-ProteinID: NP_001106694
RGD: 2290038
Ensembl: ENSRNOG00000061299
UniProt: P11517 A0A1K0FUA6
Position
1q32
AA seq 147 aa
MVHLTDAEKATVSGLWGKVNADNVGAEALGRLLVVYPWTQRYFSKFGDLSSASAIMGNPQ
VKAHGKKVINAFNDGLKHLDNLKGTFAHLSELHCDKLHVDPENFRLLGNMIVIVLGHHLG
KEFTPCAQAAFQKVVAGVASALAHKYH
NT seq 444 nt   +upstreamnt  +downstreamnt
atggtgcacctaactgatgctgagaaggctactgttagtggcctgtggggaaaggtgaat
gctgataatgttggcgctgaggccctgggcaggctgctggttgtctacccttggacccag
aggtacttttctaaatttggggacctgtcctctgcctctgctatcatgggtaacccccag
gtgaaggcccatggcaagaaggtgataaatgccttcaatgatggcctgaaacacttggac
aacctcaagggcacctttgctcatctgagtgaactccactgtgacaagctgcatgtggat
cctgagaacttcaggctcctgggcaatatgattgtgattgtgttgggccaccacctgggc
aaggaattcaccccctgtgcacaggctgccttccagaaggtggtggctggagtggccagt
gccctggctcacaagtaccactaa

DBGET integrated database retrieval system