KEGG   Rattus norvegicus (rat): 100134871
Entry
100134871         CDS       T01003                                 

Definition
(RefSeq) hemoglobin subunit beta-2
  KO
K13823  hemoglobin subunit beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05143  African trypanosomiasis
rno05144  Malaria
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    100134871
   05143 African trypanosomiasis
    100134871
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    100134871
Membrane trafficking [BR:rno04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    100134871
SSDB
Motif
Pfam: Globin
Other DBs
NCBI-GeneID: 100134871
NCBI-ProteinID: NP_001106694
RGD: 2290038
Ensembl: ENSRNOG00000061299
UniProt: P11517 A0A1K0FUA6
Position
1
AA seq 147 aa
MVHLTDAEKATVSGLWGKVNADNVGAEALGRLLVVYPWTQRYFSKFGDLSSASAIMGNPQ
VKAHGKKVINAFNDGLKHLDNLKGTFAHLSELHCDKLHVDPENFRLLGNMIVIVLGHHLG
KEFTPCAQAAFQKVVAGVASALAHKYH
NT seq 444 nt   +upstreamnt  +downstreamnt
atggtgcacctaactgatgctgagaaggctactgttagtggcctgtggggaaaggtgaat
gctgataatgttggcgctgaggccctgggcaggctgctggttgtctacccttggacccag
aggtacttttctaaatttggggacctgtcctctgcctctgctatcatgggtaacccccag
gtgaaggcccatggcaagaaggtgataaatgccttcaatgatggcctgaaacacttggac
aacctcaagggcacctttgctcatctgagtgaactccactgtgacaagctgcatgtggat
cctgagaacttcaggctcctgggcaatatgattgtgattgtgttgggccaccacctgggc
aaggaattcaccccctgtgcacaggctgccttccagaaggtggtggctggagtggccagt
gccctggctcacaagtaccactaa

KEGG   Rattus norvegicus (rat): 24440
Entry
24440             CDS       T01003                                 

Gene name
Hbb
Definition
(RefSeq) hemoglobin subunit beta-1
  KO
K13823  hemoglobin subunit beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05143  African trypanosomiasis
rno05144  Malaria
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    24440 (Hbb)
   05143 African trypanosomiasis
    24440 (Hbb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    24440 (Hbb)
Membrane trafficking [BR:rno04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    24440 (Hbb)
SSDB
Motif
Pfam: Globin
Other DBs
NCBI-GeneID: 24440
NCBI-ProteinID: NP_150237
RGD: 2783
Ensembl: ENSRNOG00000058105
UniProt: P02091
Structure
PDB: 
3HF4 3DHT

Position
1
AA seq 147 aa
MVHLTDAEKAAVNGLWGKVNPDDVGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNPK
VKAHGKKVINAFNDGLKHLDNLKGTFAHLSELHCDKLHVDPENFRLLGNMIVIVLGHHLG
KEFTPCAQAAFQKVVAGVASALAHKYH
NT seq 444 nt   +upstreamnt  +downstreamnt
atggtgcacctgactgatgctgagaaggctgctgttaatggcctgtggggaaaggtgaac
cctgatgatgttggtggcgaggccctgggcaggctgctggttgtctacccttggacccag
aggtactttgatagctttggggacctgtcctctgcctctgctatcatgggtaaccctaag
gtgaaggcccatggcaagaaggtgataaacgccttcaatgatggcctgaaacacttggac
aacctcaagggcacctttgctcatctgagtgaactccactgtgacaagctgcatgtggat
cctgagaacttcaggctcctgggcaatatgattgtgattgtgttgggccaccacctgggc
aaggaattcaccccctgtgcacaggctgccttccagaaggtggtggctggagtggccagt
gccctggctcacaagtaccactaa

KEGG   Rattus norvegicus (rat): 25632
Entry
25632             CDS       T01003                                 

Gene name
Hba-a1
Definition
(RefSeq) hemoglobin subunit alpha-1/2
  KO
K13822  hemoglobin subunit alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05143  African trypanosomiasis
rno05144  Malaria
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    25632 (Hba-a1)
   05143 African trypanosomiasis
    25632 (Hba-a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25632 (Hba-a1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   25632 (Hba-a1)
SSDB
Motif
Pfam: Globin
Other DBs
NCBI-GeneID: 25632
NCBI-ProteinID: NP_037228
RGD: 2782
Ensembl: ENSRNOG00000029886
UniProt: P01946 B1H216
Structure
PDB: 
3HF4 3DHT

Position
10
AA seq 142 aa
MVLSADDKTNIKNCWGKIGGHGGEYGEEALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG
KKVADALAKAADHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP
AMHASLDKFLASVSTVLTSKYR
NT seq 429 nt   +upstreamnt  +downstreamnt
atggtgctctctgcagatgacaaaaccaacatcaagaactgctgggggaagattggtggc
catggtggtgaatatggcgaggaggccctacagaggatgttcgctgccttccccaccacc
aagacctacttctctcacattgatgtaagccccggctctgcccaggtcaaggctcacggc
aagaaggttgctgatgccttggccaaagctgcagaccacgtcgaagacctgcctggtgcc
ctgtccactctgagcgacctgcatgcccacaaactgcgtgtggatcctgtcaacttcaag
ttcctgagccactgcctgctggtgaccttggcttgccaccaccctggagatttcacaccc
gccatgcacgcctctctggacaaattccttgcctctgtgagcactgtgctgacctccaag
taccgttaa

KEGG   Rattus norvegicus (rat): 287167
Entry
287167            CDS       T01003                                 

Gene name
Hba-a3
Definition
(RefSeq) hemoglobin alpha, adult chain 3
  KO
K13822  hemoglobin subunit alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05143  African trypanosomiasis
rno05144  Malaria
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    287167 (Hba-a3)
   05143 African trypanosomiasis
    287167 (Hba-a3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    287167 (Hba-a3)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   287167 (Hba-a3)
SSDB
Motif
Pfam: Globin
Other DBs
NCBI-GeneID: 287167
NCBI-ProteinID: NP_001013875
RGD: 1359209
Ensembl: ENSRNOG00000045989
UniProt: Q63910
Position
10
AA seq 142 aa
MVLSEEDKNNIKKAWVKIGNHAAEIGAETIGRLFIVFPSSKTYFPHFNTSEGSDQVKAHG
KKVADALTNAASHLDDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLASHHPGDFTP
AMHASLDKFFASVSTVLTSKYR
NT seq 429 nt   +upstreamnt  +downstreamnt
atggtgctctctgaagaggacaaaaacaacatcaagaaagcctgggtgaagattggtaac
catgctgctgaaattggcgcagagaccatagggaggttgttcattgtcttcccctcctcc
aagacctacttccctcactttaatacaagtgagggctccgaccaggtcaaggctcacggc
aagaaggttgctgatgccctgaccaatgctgcaagccacctcgatgacctgcctggtgcc
ctgtccactctgagcgacctgcatgcccacaaactgcgtgtggatcctgtcaacttcaag
ttcttgagccactgcctgctggtgaccttggctagccaccaccctggggatttcacaccc
gccatgcacgcctctctggacaaattctttgcctctgtgagcactgtgttgacttccaag
taccgttaa

KEGG   Rattus norvegicus (rat): 360504
Entry
360504            CDS       T01003                                 

Gene name
Hba-a2
Definition
(RefSeq) hemoglobin alpha, adult chain 2
  KO
K13822  hemoglobin subunit alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05143  African trypanosomiasis
rno05144  Malaria
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    360504 (Hba-a2)
   05143 African trypanosomiasis
    360504 (Hba-a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    360504 (Hba-a2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   360504 (Hba-a2)
SSDB
Motif
Pfam: Globin
Other DBs
NCBI-GeneID: 360504
NCBI-ProteinID: NP_001007723
RGD: 1359364
Ensembl: ENSRNOG00000047321
UniProt: P01946 A0A0G2JSV6
Position
10
AA seq 142 aa
MVLSAADKTNIKNCWGKIGGHGGEYGEEALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG
KKVADALAKAADHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP
AMHASLDKFLASVSTVLTSKYR
NT seq 429 nt   +upstreamnt  +downstreamnt
atggtgctctctgcagctgacaaaaccaacatcaagaactgctgggggaagattggtggc
catggtggtgaatatggcgaggaggccctacagaggatgttcgctgccttccccaccacc
aagacctacttctctcacattgatgtaagccccggctctgcccaggtcaaggctcacggc
aagaaggttgctgatgccctggccaaagctgcagaccacgtcgaagacctgcctggtgcc
ctgtccactctgagcgacctgcatgcccacaaactgcgtgtggatcctgtcaacttcaag
ttcctgagccactgcctgctggtgaccttggcttgccaccaccctggggatttcacacct
gccatgcacgcctctctggacaaattccttgcctctgtgagcaccgtgctgacctccaag
taccgttaa

KEGG   Rattus norvegicus (rat): 361619
Entry
361619            CDS       T01003                                 

Gene name
Hbb-b1
Definition
(RefSeq) hemoglobin, beta adult major chain
  KO
K13823  hemoglobin subunit beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05143  African trypanosomiasis
rno05144  Malaria
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    361619 (Hbb-b1)
   05143 African trypanosomiasis
    361619 (Hbb-b1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    361619 (Hbb-b1)
Membrane trafficking [BR:rno04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    361619 (Hbb-b1)
SSDB
Motif
Pfam: Globin
Other DBs
NCBI-GeneID: 361619
NCBI-ProteinID: NP_942071
RGD: 1595848
Ensembl: ENSRNOG00000047098
UniProt: Q62669 Q6PDU6
Position
1
AA seq 147 aa
MVHLTDAEKATVNGLWGKVNPVEIGAESLASLLIVYPWTQRYFSKFGDLSSVSAIMGNPQ
VKAHGKKVINAFDDGLKHLDNLKGTFGSLSELHCDKLHVDPENFRLLGNMIVIMMGHHLG
KEFTPSAQAAFQKVVAGVASALAHKYH
NT seq 444 nt   +upstreamnt  +downstreamnt
atggtgcacctaactgatgctgagaaggctactgttaatggcctgtggggaaaggtgaac
cctgttgaaattggcgctgagtcccttgccagtctgcttattgtctacccttggacccag
aggtacttttctaaatttggggacctgtcctctgtctctgctatcatgggtaacccccag
gtgaaggcccatggcaaaaaggtgataaacgccttcgatgatggcctgaaacacttggac
aacctcaagggcacctttggcagcctcagtgaactccactgtgacaagctgcatgtggat
cctgagaacttcaggctcctgggcaatatgattgtgattatgatgggccaccacctgggc
aaagaattcaccccgagtgcacaggctgccttccagaaggtggtggctggagtggccagt
gccctggctcacaagtaccactaa

KEGG   Rattus norvegicus (rat): 689064
Entry
689064            CDS       T01003                                 

Gene name
Hbb-bs
Definition
(RefSeq) hemoglobin subunit beta-2
  KO
K13823  hemoglobin subunit beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05143  African trypanosomiasis
rno05144  Malaria
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    689064 (Hbb-bs)
   05143 African trypanosomiasis
    689064 (Hbb-bs)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    689064 (Hbb-bs)
Membrane trafficking [BR:rno04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    689064 (Hbb-bs)
SSDB
Motif
Pfam: Globin
Other DBs
NCBI-GeneID: 689064
NCBI-ProteinID: NP_001104739
RGD: 1597422
Ensembl: ENSRNOG00000047098
UniProt: P11517 A0A1K0FUA6
Position
1
AA seq 147 aa
MVHLTDAEKATVSGLWGKVNADNVGAEALGRLLVVYPWTQRYFSKFGDLSSASAIMGNPQ
VKAHGKKVINAFNDGLKHLDNLKGTFAHLSELHCDKLHVDPENFRLLGNMIVIVLGHHLG
KEFTPCAQAAFQKVVAGVASALAHKYH
NT seq 444 nt   +upstreamnt  +downstreamnt
atggtgcacctaactgatgctgagaaggctactgttagtggcctgtggggaaaggtgaat
gctgataatgttggcgctgaggccctgggcaggctgctggttgtctacccttggacccag
aggtacttttctaaatttggggacctgtcctctgcctctgctatcatgggtaacccccag
gtgaaggcccatggcaagaaggtgataaatgccttcaatgatggcctgaaacacttggac
aacctcaagggcacctttgctcatctgagtgaactccactgtgacaagctgcatgtggat
cctgagaacttcaggctcctgggcaatatgattgtgattgtgttgggccaccacctgggc
aaggaattcaccccgtgtgcacaggctgccttccagaaggtggtggctggagtggccagt
gccctggctcacaagtaccactaa

DBGET integrated database retrieval system