KEGG   Rattus norvegicus (rat): 100145871
Entry
100145871         CDS       T01003                                 

Gene name
Adh5
Definition
(RefSeq) alcohol dehydrogenase 5 (class III), chi polypeptide
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00071  Fatty acid degradation
rno00350  Tyrosine metabolism
rno00830  Retinol metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100145871 (Adh5)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100145871 (Adh5)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    100145871 (Adh5)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100145871 (Adh5)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100145871 (Adh5)
   00982 Drug metabolism - cytochrome P450
    100145871 (Adh5)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    100145871 (Adh5)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     100145871 (Adh5)
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     100145871 (Adh5)
SSDB
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C UDPG_MGDP_dh_N 2-Hacid_dh_C
Other DBs
NCBI-GeneID: 100145871
NCBI-ProteinID: NP_001119592
RGD: 2292706
Ensembl: ENSRNOG00000046357
UniProt: P12711
Position
2q44
AA seq 374 aa
MANQVIRCKAAVAWEAGKPLSIEEIEVAPPQAHEVRIKIIATAVCHTDAYTLSGADPEGC
FPVILGHEGAGIVESVGEGVTKLKAGDTVIPLYIPQCGECKFCLNPKTNLCQKIRVTQGK
GLMPDGTSRFTCKGKPILHFMGTSTFSEYTVVADISVAKIDPSAPLDKVCLLGCGISTGY
GAAVNTAKVEPGSTCAVFGLGGVGLAVIMGCKVAGASRIIGIDINKDKFAKAKEFGATEC
INPQDFSKSIQEVLIEMTDGGVDFSFECIGNVKVMRSALEAAHKGWGVSVVVGVAASGEE
ISTRPFQLVTGRTWKGTAFGGWKSVESVPKLVSEYMSKKIKVDEFVTGNLSFDQINKAFD
LMHSGNSIRTVLKM
NT seq 1125 nt   +upstreamnt  +downstreamnt
atggcgaaccaggtgatcaggtgtaaggctgcagtcgcctgggaggccggaaagcctctc
tccatagaggagatagaggtggcccctccacaggctcatgaagttcgaattaagatcatt
gccactgctgtttgccacaccgatgcctataccctgagtggagctgatcctgaggggtgt
ttccccgtgatcttaggacatgaaggcgctggcattgtggagagtgttggcgaaggggtt
actaagctgaaggcaggtgataccgtcatcccgctgtacatcccacagtgtggagaatgc
aagttctgtctgaatcctaaaacaaacctttgccagaaaataagagtcactcaggggaaa
gggttgatgcccgatgggaccagcaggtttacctgcaaagggaagcctattcttcacttc
atgggaaccagcacgttttccgagtacacagtggtggcagacatctctgttgctaaaatt
gacccttccgcccctttggataaagtctgccttctcggttgtggcatttcaactggctac
ggggccgctgtgaacactgccaaggtggagcctggttctacctgtgccgtctttggcctg
ggaggagttggattggcggtgatcatgggctgtaaagtggctggtgcgtcccggatcatt
ggtattgacatcaataaagataaattcgcgaaggccaaagaatttggagccactgaatgt
attaacccccaagatttcagtaaatccatccaggaagtcctcatcgagatgacagatggc
ggagtggacttctcctttgagtgtatcggtaacgtgaaggtcatgagatcagccctcgag
gcagcccacaaaggctggggtgtcagtgtggtggttggtgtggccgcttcaggtgaagaa
atctccactcgtccgttccaactggtgacaggacgcacgtggaaaggcactgcctttgga
ggctggaagagtgtggagagtgtcccgaagctggtgtctgaatatatgtccaaaaagata
aaagttgacgaatttgtgactggcaatctgtccttcgaccagattaacaaagcctttgat
ctgatgcactcgggaaacagcattcgaactgttctaaagatgtaa

DBGET integrated database retrieval system