KEGG   Rattus norvegicus (rat): 100174910Help
Entry
100174910         CDS       T01003                                 

Definition
(RefSeq) glutaredoxin-like protein
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF836 Glutaredoxin Thioredoxin_2
Motif
Other DBs
NCBI-GeneID: 100174910
NCBI-ProteinID: NP_001124475
RGD: 2299854
Ensembl: ENSRNOG00000013738
UniProt: G3V7R5 B2RYV3
Position
18q12.1
AA seq 115 aa AA seqDB search
MLWFQGNSLQIARSSFGLLRNLSASNTALPVLTLFTKHPCPLCDEAKEVLQPYKNRFILQ
EVDITLPENSTWYERYKFDIPVFHLNGQFLMKHRVNTSKLETQLLKLEQQVLETN
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgctctggtttcaaggaaatagcctgcagattgccagatcctcctttggactcttgaga
aatctctctgcctctaacacggctctgcctgtgctgaccttattcacaaagcacccatgc
cccctatgtgatgaagctaaagaagtgctccagccttataaaaacaggtttattttacag
gaggtggacatcacacttcccgaaaattctacttggtatgaaaggtataaatttgacatc
cccgtcttccatttgaatggccagtttctgatgaagcaccgagtaaatacctcaaagctt
gaaacacagcttctgaaacttgagcagcaggtgctggagacaaactga

DBGET integrated database retrieval system