KEGG   Rattus norvegicus (rat): 100188936Help
Entry
100188936         CDS       T01003                                 

Gene name
Ormdl1
Definition
(RefSeq) ORMDL sphingolipid biosynthesis regulator 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: ORMDL
Motif
Other DBs
NCBI-GeneID: 100188936
NCBI-ProteinID: NP_001128176
RGD: 2300146
Ensembl: ENSRNOG00000042961
UniProt: E9PSZ0
Position
9q22
AA seq 122 aa AA seqDB search
MNVGVAHSEVNPNTRVMNSRGMWLTYALGVGLLHIVFLSIPFCSVPVAWTLTNIIHNLVS
PRILAGEVAQDIWCREPGTPHHRQALTEEVLRPQRESKKLQDAGRRQPILATGTTDTENS
DA
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgaatgttggagttgcccacagtgaggtaaaccccaatactcgtgtaatgaatagccgt
ggtatgtggctgacatatgctttgggagttggcctgcttcacattgtatttctcagcatc
cccttctgcagtgttcctgttgcctggaccttaacaaacataatacataatctggtgtcc
ccgcgtattcttgctggcgaggtcgcgcaggacatttggtgccgagaacccgggacgcca
caccatcgccaggcgctgacagaggaggtcctccgtccgcagagagaatccaaaaagctg
caggacgcgggaagaagacaacccattctggctaccggaacgactgacacggagaattct
gacgcctaa

DBGET integrated database retrieval system