KEGG   Rattus norvegicus (rat): 100188937
Entry
100188937         CDS       T01003                                 

Gene name
Cox7c
Definition
(RefSeq) cytochrome c oxidase subunit 7C, mitochondrial
  KO
K02272  cytochrome c oxidase subunit 7c
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04260  Cardiac muscle contraction
rno04714  Thermogenesis
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100188937 (Cox7c)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100188937 (Cox7c)
  09159 Environmental adaptation
   04714 Thermogenesis
    100188937 (Cox7c)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100188937 (Cox7c)
   05012 Parkinson disease
    100188937 (Cox7c)
   05014 Amyotrophic lateral sclerosis
    100188937 (Cox7c)
   05016 Huntington disease
    100188937 (Cox7c)
   05020 Prion disease
    100188937 (Cox7c)
   05022 Pathways of neurodegeneration - multiple diseases
    100188937 (Cox7c)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    100188937 (Cox7c)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100188937 (Cox7c)
SSDB
Motif
Pfam: COX7C
Other DBs
NCBI-GeneID: 100188937
NCBI-ProteinID: NP_001128177
RGD: 2300145
Ensembl: ENSRNOG00000030237
UniProt: P80432
Position
2
AA seq 63 aa
MLGQSIRRFTTSVVRRSHYEEGPGKNLPFSVENKWRLLLMMTVYFGSGFAAPFFIVRHQL
LKK
NT seq 192 nt   +upstreamnt  +downstreamnt
atgttgggccagagtatccggaggttcaccacctccgtggtgcgtcgcagccactatgag
gagggtccggggaagaatttgccgttttcagtggaaaacaagtggcggttactgcttatg
atgaccgtgtactttggatctggatttgctgctcctttctttatagtaaggcaccagcta
cttaaaaaataa

KEGG   Rattus norvegicus (rat): 100361960
Entry
100361960         CDS       T01003                                 

Gene name
Cox7b2
Definition
(RefSeq) cytochrome c oxidase subunit 7B, mitochondrial
  KO
K02271  cytochrome c oxidase subunit 7b
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04260  Cardiac muscle contraction
rno04714  Thermogenesis
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100361960 (Cox7b2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100361960 (Cox7b2)
  09159 Environmental adaptation
   04714 Thermogenesis
    100361960 (Cox7b2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100361960 (Cox7b2)
   05012 Parkinson disease
    100361960 (Cox7b2)
   05014 Amyotrophic lateral sclerosis
    100361960 (Cox7b2)
   05016 Huntington disease
    100361960 (Cox7b2)
   05020 Prion disease
    100361960 (Cox7b2)
   05022 Pathways of neurodegeneration - multiple diseases
    100361960 (Cox7b2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    100361960 (Cox7b2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100361960 (Cox7b2)
SSDB
Motif
Pfam: COX7B
Other DBs
NCBI-GeneID: 100361960
NCBI-ProteinID: XP_006250994
RGD: 2319120
Ensembl: ENSRNOG00000057953
UniProt: A0A0G2K6P0
Position
14
AA seq 80 aa
MMLPLARCALNHLKIQSIPKVVGRQKHSKPSSNFHDKYGNMMLFSGSAFCLGAYIIFMTQ
MGVEWNLSPVGRVTPKEWNE
NT seq 243 nt   +upstreamnt  +downstreamnt
atgatgcttccattggccagatgtgcactaaaccatctcaagattcaaagcattccgaaa
gttgtgggaagacagaaacactcaaagccctcatcaaattttcatgacaaatatggcaat
atgatgctgttcagtgggtctgctttctgtctaggtgcatatataatttttatgacccag
atgggggtggagtggaacctgtctcctgtgggcagagtcacccccaaagagtggaatgag
taa

KEGG   Rattus norvegicus (rat): 171335
Entry
171335            CDS       T01003                                 

Gene name
Cox8a
Definition
(RefSeq) cytochrome c oxidase subunit 8A, mitochondrial precursor
  KO
K02273  cytochrome c oxidase subunit 8
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04260  Cardiac muscle contraction
rno04714  Thermogenesis
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    171335 (Cox8a)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    171335 (Cox8a)
  09159 Environmental adaptation
   04714 Thermogenesis
    171335 (Cox8a)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    171335 (Cox8a)
   05012 Parkinson disease
    171335 (Cox8a)
   05014 Amyotrophic lateral sclerosis
    171335 (Cox8a)
   05016 Huntington disease
    171335 (Cox8a)
   05020 Prion disease
    171335 (Cox8a)
   05022 Pathways of neurodegeneration - multiple diseases
    171335 (Cox8a)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    171335 (Cox8a)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    171335 (Cox8a)
SSDB
Motif
Pfam: COX8
Other DBs
NCBI-GeneID: 171335
NCBI-ProteinID: NP_599172
RGD: 620638
Ensembl: ENSRNOG00000021177
UniProt: P80433 Q64576
Position
1
AA seq 69 aa
MSSLTPLLLRSLTGPARRLMVPRAQVHSKPPREQLGVLDITIGLTSCFVCCLLPAGWVLS
HLESYKKRE
NT seq 210 nt   +upstreamnt  +downstreamnt
atgtcttccctgacgccgctgctgctgaggagcctgaccggcccggcccggcggcttatg
gtgccgcgggctcaggtccactcgaagccgccgcgggagcagctcggggtcctggatatc
accattgggctcacttcctgcttcgtgtgttgtcttctacctgcgggctgggtcctgtca
cacctggaaagctacaagaagcgggagtga

KEGG   Rattus norvegicus (rat): 25250
Entry
25250             CDS       T01003                                 

Gene name
Cox8b
Definition
(RefSeq) cytochrome c oxidase subunit 8B, mitochondrial precursor
  KO
K02273  cytochrome c oxidase subunit 8
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04260  Cardiac muscle contraction
rno04714  Thermogenesis
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    25250 (Cox8b)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    25250 (Cox8b)
  09159 Environmental adaptation
   04714 Thermogenesis
    25250 (Cox8b)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    25250 (Cox8b)
   05012 Parkinson disease
    25250 (Cox8b)
   05014 Amyotrophic lateral sclerosis
    25250 (Cox8b)
   05016 Huntington disease
    25250 (Cox8b)
   05020 Prion disease
    25250 (Cox8b)
   05022 Pathways of neurodegeneration - multiple diseases
    25250 (Cox8b)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    25250 (Cox8b)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    25250 (Cox8b)
SSDB
Motif
Pfam: COX8
Other DBs
NCBI-GeneID: 25250
NCBI-ProteinID: NP_036918
RGD: 2386
Ensembl: ENSRNOG00000014656
UniProt: P16221
Position
1
AA seq 70 aa
MPRLPPILRLLQAPEKYTVIPKARISSKPAKSPTSAMDQAVGMSVIIAGFMVPAGWVLSH
LESYKRSSAA
NT seq 213 nt   +upstreamnt  +downstreamnt
atgccaaggcttccccctatcctgcggctgctccaagcgcccgagaagtacacagtgatt
cctaaagcccgtatctcttccaagccagccaaatctcccacttctgccatggatcaggct
gtggggatgtcagtcataatcgctggcttcatggttccagcaggatgggtcttatcccac
ttggagagctataagagaagctccgcagcatga

KEGG   Rattus norvegicus (rat): 25278
Entry
25278             CDS       T01003                                 

Gene name
Cox6a2
Definition
(RefSeq) cytochrome c oxidase subunit 6A2, mitochondrial precursor
  KO
K02266  cytochrome c oxidase subunit 6a
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04260  Cardiac muscle contraction
rno04714  Thermogenesis
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    25278 (Cox6a2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    25278 (Cox6a2)
  09159 Environmental adaptation
   04714 Thermogenesis
    25278 (Cox6a2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    25278 (Cox6a2)
   05012 Parkinson disease
    25278 (Cox6a2)
   05014 Amyotrophic lateral sclerosis
    25278 (Cox6a2)
   05016 Huntington disease
    25278 (Cox6a2)
   05020 Prion disease
    25278 (Cox6a2)
   05022 Pathways of neurodegeneration - multiple diseases
    25278 (Cox6a2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    25278 (Cox6a2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    25278 (Cox6a2)
SSDB
Motif
Pfam: COX6A
Other DBs
NCBI-GeneID: 25278
NCBI-ProteinID: NP_036944
RGD: 2385
Ensembl: ENSRNOG00000019851
UniProt: G3V8M4
Position
1
AA seq 97 aa
MALPLKVLSRSMASASKGDHGGAGANTWRLLTFVLALPSVALCSLNCWMHAGHHERPEFI
PYHHLRIRTKPFSWGDGNHTLFHNPHVNPLPTGYEQP
NT seq 294 nt   +upstreamnt  +downstreamnt
atggctctgcctcttaaggtcctcagtcggagcatggccagcgcatccaaaggagaccac
ggaggcgcaggagccaacacttggcgcctcctgacctttgtgctggctctccccagcgta
gctctctgctcgcttaactgctggatgcacgctggccaccatgagcgcccagaattcatc
ccctatcaccacctccgcatccgaaccaagcccttctcctggggggatgggaaccacacg
cttttccacaatccccacgtcaatcctttgcccaccggctacgagcagccttga

KEGG   Rattus norvegicus (rat): 25282
Entry
25282             CDS       T01003                                 

Gene name
Cox6a1
Definition
(RefSeq) cytochrome c oxidase subunit 6A1, mitochondrial precursor
  KO
K02266  cytochrome c oxidase subunit 6a
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04260  Cardiac muscle contraction
rno04714  Thermogenesis
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    25282 (Cox6a1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    25282 (Cox6a1)
  09159 Environmental adaptation
   04714 Thermogenesis
    25282 (Cox6a1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    25282 (Cox6a1)
   05012 Parkinson disease
    25282 (Cox6a1)
   05014 Amyotrophic lateral sclerosis
    25282 (Cox6a1)
   05016 Huntington disease
    25282 (Cox6a1)
   05020 Prion disease
    25282 (Cox6a1)
   05022 Pathways of neurodegeneration - multiple diseases
    25282 (Cox6a1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    25282 (Cox6a1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    25282 (Cox6a1)
SSDB
Motif
Pfam: COX6A
Other DBs
NCBI-GeneID: 25282
NCBI-ProteinID: NP_036946
RGD: 2384
Ensembl: ENSRNOG00000001170
UniProt: P10818
Position
12
AA seq 111 aa
MASAVLSASRVSGLLGRALPRVGRPMSSGAHGEEGSARIWKALTYFVALPGVGVSMLNVF
LKSRHEEHERPEFVAYPHLRIRTKPFPWGDGNHTLFHNPHMNPLPTGYEDE
NT seq 336 nt   +upstreamnt  +downstreamnt
atggcgtcggcggtgctgagtgcgtctcgagtctctgggctgctgggccgggccctccca
cgggtggggcggcccatgtcgagtggcgcccacggcgaggagggttcagctcgtatttgg
aaggccctcacctacttcgtggcgctgcccggggtgggagtgagcatgctcaacgttttc
ctgaagtcgcgacacgaagagcacgagagacccgagttcgtcgcctacccccatctccgc
atcaggactaagcccttcccctggggagatggtaaccataccctcttccacaatcctcac
atgaacccgcttccgactggctatgaagatgagtaa

KEGG   Rattus norvegicus (rat): 252934
Entry
252934            CDS       T01003                                 

Gene name
Cox5a
Definition
(RefSeq) cytochrome c oxidase subunit 5A, mitochondrial precursor
  KO
K02264  cytochrome c oxidase subunit 5a
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04260  Cardiac muscle contraction
rno04714  Thermogenesis
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    252934 (Cox5a)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    252934 (Cox5a)
  09159 Environmental adaptation
   04714 Thermogenesis
    252934 (Cox5a)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    252934 (Cox5a)
   05012 Parkinson disease
    252934 (Cox5a)
   05014 Amyotrophic lateral sclerosis
    252934 (Cox5a)
   05016 Huntington disease
    252934 (Cox5a)
   05020 Prion disease
    252934 (Cox5a)
   05022 Pathways of neurodegeneration - multiple diseases
    252934 (Cox5a)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    252934 (Cox5a)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    252934 (Cox5a)
SSDB
Motif
Pfam: COX5A
Other DBs
NCBI-GeneID: 252934
NCBI-ProteinID: NP_665726
RGD: 620607
Ensembl: ENSRNOG00000018816
UniProt: P11240
Position
8
AA seq 146 aa
MLAAALRRCTAAAAARGLLHPVSAPSPAAAVCSIRCYSHGSHETDEEFDARWVTYFNKPD
IDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYP
YVIQELRPTLNELGISTPEELGLDKV
NT seq 441 nt   +upstreamnt  +downstreamnt
atgctcgccgctgccctccgtcgctgtaccgcagccgcggccgcccgaggccttctgcac
cccgtctcggctcccagccccgctgccgctgtctgttccattcgctgctattctcatggg
tcacatgagacagatgaggagtttgatgctcgctgggtgacatacttcaacaagccagac
attgatgcctgggagttgcgtaaagggatgaatacacttgttggctatgatctggttcct
gagcccaaaatcattgatgctgctttgagggcatgtagacggttaaatgattttgctagt
gctgttcgcatcttggaggttgttaaggacaaagcaggacctcataaggaaatctacccc
tatgtcatccaggaacttagaccaactttaaatgaattgggaatctccactccagaggaa
ctgggccttgacaaagtgtaa

KEGG   Rattus norvegicus (rat): 26195
Entry
26195             CDS       T01003                                 

Gene name
COX1
Definition
(RefSeq) cytochrome c oxidase subunit I
  KO
K02256  cytochrome c oxidase subunit 1 [EC:7.1.1.9]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04260  Cardiac muscle contraction
rno04714  Thermogenesis
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    26195 (COX1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    26195 (COX1)
  09159 Environmental adaptation
   04714 Thermogenesis
    26195 (COX1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    26195 (COX1)
   05012 Parkinson disease
    26195 (COX1)
   05014 Amyotrophic lateral sclerosis
    26195 (COX1)
   05016 Huntington disease
    26195 (COX1)
   05020 Prion disease
    26195 (COX1)
   05022 Pathways of neurodegeneration - multiple diseases
    26195 (COX1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    26195 (COX1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    26195 (COX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    26195 (COX1)
Enzymes [BR:rno01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.9  cytochrome-c oxidase
     26195 (COX1)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Cytochrome c oxidase
    26195 (COX1)
SSDB
Motif
Pfam: COX1
Other DBs
NCBI-GeneID: 26195
NCBI-ProteinID: YP_665631
RGD: 621871
UniProt: P05503 Q8HIC9
Position
MT
AA seq 514 aa
MLVNRWLFSTNHKDIGTLYLLFGAWAGMVGTALSILIRAELGQPGALLGDDQIYNVIVTA
HAFVMIFFMVMPMMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEA
GAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMTQYQ
TPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGH
PEVYILILPGFGIISHVVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGLDVD
TRAYFTSATMIIAIPTGVKVFSWLATLHGGNIKWSPAMLWALGFIFLFTVGGLTGIVLSN
SSLDIVLHDTYYVVAHFHYVLSMGAVFAIMAGFVHWFPLFSGYTLNDTWAKAHFAIMFVG
VNMTFFPQHFLGLAGMPRRYSDYPDAYTTWNTVSSMGSFISLTAVLVMIFMIWEAFASKR
EVLSISYSSTNLEWLHGCPPPYHTFEEPSYVKVK
NT seq 1545 nt   +upstreamnt  +downstreamnt
atgctcgtaaaccgttgactcttttcaactaaccacaaagatatcggaaccctctaccta
ttatttggagcctgagcaggaatagtagggacagctttaagtattctaattcgagctgaa
ctaggacagccaggcgcactcctaggagatgaccaaatctataatgtcatcgtcacagcc
catgcattcgtaataattttctttatagtaatacctataataattggaggcttcgggaac
tgacttgtaccactaataattggagcccctgatatagcattcccacgaataaataacata
agcttttgactgcttcctccatcatttctactccttttagcatcctccatagtagaagct
ggagctggaacaggatgaacagtatatccccccttagccggaaacctagcccatgctgga
gcatccgtagatttaactattttttccctccacctagccggggtgtcttctatcttagga
gctatcaactttatcaccactatcattaatataaaaccccctgctataacccaatatcag
acacctctctttgtatgatccgtactaattacagccgtcctactacttctctcactgcca
gtattagcagcaggtatcactatactccttacagaccgaaatctaaatactactttcttc
gaccccgctggaggtggagacccaatcctttatcaacacctattctgattcttcggccac
ccagaagtgtacatcttaattcttccagggtttggaattatttcacatgtagttacctat
tactctggaaaaaaagaacccttcggatatataggtatggtatgagccataatatctatt
ggcttcctaggatttattgtatgagcacatcacatattcacagtaggcctagatgtagac
acccgagcctactttacatctgccactataattatcgcaattcctacaggcgtaaaagta
ttcagctgactcgctacactacatggaggaaatatcaaatgatcccccgccatattatga
gccttagggtttatcttcttattcacagtagggggcctaacagggatcgtactatctaac
tcatcccttgacattgtacttcatgatacatactatgtagtagctcacttccactatgtc
ttatctataggagcagtattcgccatcatagctggcttcgtccactgattcccactattc
tcaggctataccctaaatgacacatgagcaaaagcccactttgccattatatttgtaggt
gtaaacataacattctttcctcaacacttcctaggattagcagggatacctcgtcgttac
tctgattatccagatgcttacaccacatgaaatacagtctcctctataggctcattcatc
tcacttacggccgtccttgtaatgatcttcatgatttgagaagccttcgcatcaaaacga
gaagtactctcaatttcctactcctcaactaacctagaatgactgcatggatgcccccca
ccctaccacacattcgaagaaccttcctatgtaaaagttaaataa

KEGG   Rattus norvegicus (rat): 26198
Entry
26198             CDS       T01003                                 

Gene name
COX2
Definition
(RefSeq) cytochrome c oxidase subunit II
  KO
K02261  cytochrome c oxidase subunit 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04260  Cardiac muscle contraction
rno04714  Thermogenesis
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    26198 (COX2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    26198 (COX2)
  09159 Environmental adaptation
   04714 Thermogenesis
    26198 (COX2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    26198 (COX2)
   05012 Parkinson disease
    26198 (COX2)
   05014 Amyotrophic lateral sclerosis
    26198 (COX2)
   05016 Huntington disease
    26198 (COX2)
   05020 Prion disease
    26198 (COX2)
   05022 Pathways of neurodegeneration - multiple diseases
    26198 (COX2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    26198 (COX2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    26198 (COX2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    26198 (COX2)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Cytochrome c oxidase
    26198 (COX2)
SSDB
Motif
Pfam: COX2 COX2_TM
Other DBs
NCBI-GeneID: 26198
NCBI-ProteinID: YP_665632
RGD: 621872
UniProt: P00406 Q8SEZ5
Position
MT
AA seq 227 aa
MAYPFQLGLQDATSPIMEELTNFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE
VETIWTILPAVILILIALPSLRILYMMDEINNPVLTVKTMGHQWYWSYEYTDYEDLCFDS
YMIPTNDLKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN
QATVTSNRPGLFYGQCSEICGSNHSFMPIVLEMVPLKYFENWSASMI
NT seq 684 nt   +upstreamnt  +downstreamnt
atggcttacccatttcaacttggcttacaagacgccacatcacctatcatagaagaactt
acaaactttcatgaccacaccctaataattgtattcctcatcagctccctagtactttat
attatttcactaatactaacaacaaaactaacacacacaagcacaatagacgcccaagaa
gtagaaacaatttgaacaattctcccagctgtcattcttattctaattgcccttccctcc
ctacgaattctatacataatagacgagattaataacccagttctaacagtaaagactata
ggacaccaatgatactgaagctatgaatatactgactatgaagacctatgctttgactcc
tacataatcccaaccaatgacctaaaaccaggtgaacttcgtctattagaagttgataat
cgggtagtcttaccaatagaacttccaatccgtatactaatctcatccgaagacgtcctg
cactcatgagccgtcccttcactagggttaaaaaccgacgcaatccccggccgcctaaac
caagctacagtgacatcaaaccgaccaggtctattctatggccaatgctctgaaatttgc
ggctcaaatcacagcttcatacccattgtactagaaatagtccctctaaaatatttcgaa
aactgatcagcttctataatttaa

KEGG   Rattus norvegicus (rat): 26204
Entry
26204             CDS       T01003                                 

Gene name
COX3
Definition
(RefSeq) cytochrome c oxidase subunit III
  KO
K02262  cytochrome c oxidase subunit 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04260  Cardiac muscle contraction
rno04714  Thermogenesis
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    26204 (COX3)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    26204 (COX3)
  09159 Environmental adaptation
   04714 Thermogenesis
    26204 (COX3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    26204 (COX3)
   05012 Parkinson disease
    26204 (COX3)
   05014 Amyotrophic lateral sclerosis
    26204 (COX3)
   05016 Huntington disease
    26204 (COX3)
   05020 Prion disease
    26204 (COX3)
   05022 Pathways of neurodegeneration - multiple diseases
    26204 (COX3)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    26204 (COX3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    26204 (COX3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    26204 (COX3)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Cytochrome c oxidase
    26204 (COX3)
SSDB
Motif
Pfam: COX3
Other DBs
NCBI-GeneID: 26204
NCBI-ProteinID: YP_665635
RGD: 621873
UniProt: P05505 Q7H115
Position
MT
AA seq 261 aa
MTHQTHAYHMVNPSPWPLTGALSALLLTSGLVMWFHYNSTILLSLGLLTNILTMYQWWRD
IIREGTYQGHHTPIVQKGLRYGMILFIVSEVFFFAGFFWAFYHSSLVPTHDLGGCWPPTG
ITPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGNRNHMNQALLITILLGLYFTILQASE
YFETSFSISDGIYGSTFFMATGFHGLHVIIGSTFLIVCLLRQLKFHFTSKHHFGFEAAAW
YWHFVDVVWLFLYVSIYWWGS
NT seq 784 nt   +upstreamnt  +downstreamnt
atgacccaccaaacccatgcataccatatagtaaacccaagcccatgaccactaacagga
gccctatcagctcttctacttacatccggcttagtaatatgattccattacaactccaca
attctcctatcattaggcctcctgacaaacatcctaactatatatcaatgatgacgagat
atcatccgtgaaggaacataccaaggccaccacacccctattgtacaaaaaggcctccga
tacggaataatcctgtttattgtctccgaagtattcttctttgccggatttttctgagca
ttttatcattccagcctagttcctacccacgacctaggcggttgctgacccccaacagga
attacccctttaaatcccctagaagtaccccttctaaatacatcagtcctcttagcatca
ggagtctcaattacatgagcccatcacagcctaatagaaggcaaccgaaaccatataaac
caagccctactaatcaccattctcttaggattatatttcactatcttacaagcctcagag
tatttcgaaacatcattttctatctcagacggaatttacggctcaacattcttcatagca
acgggatttcatggcctccacgtaattattggctcaactttcctaattgtctgtctacta
cgacaactaaaattccacttcacatcaaaacatcatttcggatttgaagccgcagcatga
tactgacacttcgtagatgtagtttgactattcctatacgtttctatctattgatgagga
tcct

KEGG   Rattus norvegicus (rat): 29445
Entry
29445             CDS       T01003                                 

Gene name
Cox4i1
Definition
(RefSeq) cytochrome c oxidase subunit 4 isoform 1, mitochondrial precursor
  KO
K02263  cytochrome c oxidase subunit 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04260  Cardiac muscle contraction
rno04714  Thermogenesis
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    29445 (Cox4i1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    29445 (Cox4i1)
  09159 Environmental adaptation
   04714 Thermogenesis
    29445 (Cox4i1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    29445 (Cox4i1)
   05012 Parkinson disease
    29445 (Cox4i1)
   05014 Amyotrophic lateral sclerosis
    29445 (Cox4i1)
   05016 Huntington disease
    29445 (Cox4i1)
   05020 Prion disease
    29445 (Cox4i1)
   05022 Pathways of neurodegeneration - multiple diseases
    29445 (Cox4i1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    29445 (Cox4i1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    29445 (Cox4i1)
SSDB
Motif
Pfam: COX4
Other DBs
NCBI-GeneID: 29445
NCBI-ProteinID: NP_058898
RGD: 68374
Ensembl: ENSRNOG00000017817
UniProt: P10888
Position
19
AA seq 169 aa
MLATRALSLIGKRAISTSVCLRAHGSVVKSEDYALPSYVDRRDYPLPDVAHVKLLSASQK
ALKEKEKADWSSLSRDEKVQLYRIQFNESFAEMNKGTNEWKTVVGLAMFFIGFTALVLIW
EKSYVYGPIPHTFDRDWVAMQTKRMLDMKVNPIQGFSAKWDYNKNEWKK
NT seq 510 nt   +upstreamnt  +downstreamnt
atgttggctaccagggcacttagcctaattggcaagagagccatttctacttcggtgtgc
cttcgggcacatgggagtgttgtgaagagtgaagactatgctctcccatcttatgttgat
cggcgtgactaccccttgcctgatgtggcccacgtcaagctgctgtctgccagccagaag
gccctgaaggagaaggagaaggccgactggagcagcctttccagggatgagaaagtccaa
ttgtaccgcatccagtttaacgagagcttcgctgagatgaacaagggcaccaatgagtgg
aagacagtggtgggcctggccatgttcttcatcggcttcactgcgcttgtgctgatctgg
gagaagagctacgtgtatggccccatccctcatacctttgatcgtgactgggtggccatg
cagaccaagcggatgctggacatgaaggtcaaccccattcagggcttctccgccaagtgg
gactacaacaagaatgaatggaagaagtga

KEGG   Rattus norvegicus (rat): 29507
Entry
29507             CDS       T01003                                 

Gene name
Cox7a2
Definition
(RefSeq) cytochrome c oxidase subunit 7A2, mitochondrial precursor
  KO
K02270  cytochrome c oxidase subunit 7a
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04260  Cardiac muscle contraction
rno04714  Thermogenesis
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    29507 (Cox7a2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    29507 (Cox7a2)
  09159 Environmental adaptation
   04714 Thermogenesis
    29507 (Cox7a2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    29507 (Cox7a2)
   05012 Parkinson disease
    29507 (Cox7a2)
   05014 Amyotrophic lateral sclerosis
    29507 (Cox7a2)
   05016 Huntington disease
    29507 (Cox7a2)
   05020 Prion disease
    29507 (Cox7a2)
   05022 Pathways of neurodegeneration - multiple diseases
    29507 (Cox7a2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    29507 (Cox7a2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    29507 (Cox7a2)
SSDB
Motif
Pfam: COX7a
Other DBs
NCBI-GeneID: 29507
NCBI-ProteinID: NP_071948
RGD: 68365
Ensembl: ENSRNOG00000042903
UniProt: P35171 B2RYS0
Position
8
AA seq 83 aa
MLRNVLALRQIAQRTISTTSRRHFENKVPEKQKLFQEDNGMPVHLKGGTSDALLYRATML
LTVGGTAYAIYMLAMAAFPKKQN
NT seq 252 nt   +upstreamnt  +downstreamnt
atgctgcggaatgtgctggcccttcgtcagattgcccagaggaccatcagcaccacttca
cgaaggcattttgaaaacaaagttccagagaagcaaaagctgtttcaggaggataatggg
atgccagttcatctgaaaggcgggacatctgatgccctcctttacagagccacaatgctt
ctgacagttggtggaacagcgtatgccatctatatgttagctatggctgcattccccaag
aagcagaactga

KEGG   Rattus norvegicus (rat): 298762
Entry
298762            CDS       T01003                                 

Gene name
Cox7a2l
Definition
(RefSeq) cytochrome c oxidase subunit 7A2 like
  KO
K02270  cytochrome c oxidase subunit 7a
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04260  Cardiac muscle contraction
rno04714  Thermogenesis
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    298762 (Cox7a2l)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    298762 (Cox7a2l)
  09159 Environmental adaptation
   04714 Thermogenesis
    298762 (Cox7a2l)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    298762 (Cox7a2l)
   05012 Parkinson disease
    298762 (Cox7a2l)
   05014 Amyotrophic lateral sclerosis
    298762 (Cox7a2l)
   05016 Huntington disease
    298762 (Cox7a2l)
   05020 Prion disease
    298762 (Cox7a2l)
   05022 Pathways of neurodegeneration - multiple diseases
    298762 (Cox7a2l)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    298762 (Cox7a2l)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    298762 (Cox7a2l)
SSDB
Motif
Pfam: COX7a
Other DBs
NCBI-GeneID: 298762
NCBI-ProteinID: NP_001100174
RGD: 1306111
Ensembl: ENSRNOG00000004526
UniProt: D3ZYX8
Position
6
AA seq 120 aa
MGPAYSRLLESFHAGLEQSPRFLCVYGTLGKGFKPVSREAPPIIFATPTKLTSSVTAYDY
AGKNKVPELQRFFQKADGVPIHLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASKPKNK
NT seq 363 nt   +upstreamnt  +downstreamnt
atgggtccggcttactcgcgtctcctggaatcctttcacgcaggcttggagcagtcgccg
aggtttctctgtgtgtacggcaccctaggcaagggttttaagccggtttccagagaagca
ccgcctatcatatttgccacaccgaccaaactgacctccagtgtgacagcatatgactat
gctgggaagaataaagttccagagctacagagattcttccagaaggctgacggtgtgccc
atccacctgaaacgaggccttccggaccaaatgctttaccggaccaccatggctctcaca
gtgggagggaccatctactgcctgatcgccctctacatggcctcgaagcccaaaaacaaa
tga

KEGG   Rattus norvegicus (rat): 303393
Entry
303393            CDS       T01003                                 

Gene name
Cox7b
Definition
(RefSeq) cytochrome c oxidase subunit 7B, mitochondrial precursor
  KO
K02271  cytochrome c oxidase subunit 7b
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04260  Cardiac muscle contraction
rno04714  Thermogenesis
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    303393 (Cox7b)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    303393 (Cox7b)
  09159 Environmental adaptation
   04714 Thermogenesis
    303393 (Cox7b)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    303393 (Cox7b)
   05012 Parkinson disease
    303393 (Cox7b)
   05014 Amyotrophic lateral sclerosis
    303393 (Cox7b)
   05016 Huntington disease
    303393 (Cox7b)
   05020 Prion disease
    303393 (Cox7b)
   05022 Pathways of neurodegeneration - multiple diseases
    303393 (Cox7b)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    303393 (Cox7b)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    303393 (Cox7b)
SSDB
Motif
Pfam: COX7B
Other DBs
NCBI-GeneID: 303393
NCBI-ProteinID: NP_877971
RGD: 727789
Ensembl: ENSRNOG00000054689
Vega: OTTRNOG00000001769
UniProt: P80431
Position
X
AA seq 80 aa
MLPLAKNALSRLQVRSIQQVVARQSHQKKTPTFHDKYGNAVLAGGSIFCISAWTYTATQI
GIEWNLSPVGRVTPKEWRDQ
NT seq 243 nt   +upstreamnt  +downstreamnt
atgttgcccttggccaaaaacgcactaagtcgtctccaagttcgaagcattcagcaagtg
gtggcaaggcagagccatcagaagaagacacctactttccatgacaaatatggaaatgct
gtattagcaggtggaagcatcttctgtatttctgcatggacatatacagccacacaaatt
ggaatagaatggaacctgtcccctgttggcagagtcaccccaaaggaatggagagatcag
tag

KEGG   Rattus norvegicus (rat): 360229
Entry
360229            CDS       T01003                                 

Gene name
Cox8c
Definition
(RefSeq) cytochrome c oxidase subunit 8C, mitochondrial
  KO
K02273  cytochrome c oxidase subunit 8
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04260  Cardiac muscle contraction
rno04714  Thermogenesis
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    360229 (Cox8c)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    360229 (Cox8c)
  09159 Environmental adaptation
   04714 Thermogenesis
    360229 (Cox8c)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    360229 (Cox8c)
   05012 Parkinson disease
    360229 (Cox8c)
   05014 Amyotrophic lateral sclerosis
    360229 (Cox8c)
   05016 Huntington disease
    360229 (Cox8c)
   05020 Prion disease
    360229 (Cox8c)
   05022 Pathways of neurodegeneration - multiple diseases
    360229 (Cox8c)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    360229 (Cox8c)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    360229 (Cox8c)
SSDB
Motif
Pfam: COX8 Pro_sub2
Other DBs
NCBI-GeneID: 360229
NCBI-ProteinID: NP_898878
RGD: 727840
Ensembl: ENSRNOG00000031106
UniProt: Q7TNN2
Position
6
AA seq 72 aa
MSRLLQFCSSLLRHRVVLFSKPGHSGRLSHSESPQNQVLTPTESVVGIVVFFATFFIPAA
YVMSNLKFFKGE
NT seq 219 nt   +upstreamnt  +downstreamnt
atgtctcgcttgctgcagttctgctcttccctcctccgacaccgtgtagtcctgttctcg
aagcctggccactcaggccgcctcagccactcagaaagcccacaaaaccaagtcctgaca
cccacggaatcggttgttggaattgtcgtgttttttgccacctttttcatcccagctgcg
tatgtgatgagcaacctgaagtttttcaaaggcgagtag

KEGG   Rattus norvegicus (rat): 54322
Entry
54322             CDS       T01003                                 

Gene name
Cox6c
Definition
(RefSeq) cytochrome c oxidase subunit 6C-2
  KO
K02268  cytochrome c oxidase subunit 6c
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04260  Cardiac muscle contraction
rno04714  Thermogenesis
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    54322 (Cox6c)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    54322 (Cox6c)
  09159 Environmental adaptation
   04714 Thermogenesis
    54322 (Cox6c)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    54322 (Cox6c)
   05012 Parkinson disease
    54322 (Cox6c)
   05014 Amyotrophic lateral sclerosis
    54322 (Cox6c)
   05016 Huntington disease
    54322 (Cox6c)
   05020 Prion disease
    54322 (Cox6c)
   05022 Pathways of neurodegeneration - multiple diseases
    54322 (Cox6c)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    54322 (Cox6c)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    54322 (Cox6c)
SSDB
Motif
Pfam: COX6C
Other DBs
NCBI-GeneID: 54322
NCBI-ProteinID: NP_062233
RGD: 620616
Ensembl: ENSRNOG00000010807
UniProt: P11951
Position
7
AA seq 76 aa
MSSGALLPKPQMRGLLAKRLRVHIVGAFVVALGVAAAYKFGVAEPRKKAYADFYRNYDSM
KDFEEMRQAGVFQSAK
NT seq 231 nt   +upstreamnt  +downstreamnt
atgagttccggtgctctgttgccgaaaccacagatgcgtggtcttctggccaagcgtctg
cgggttcatattgttggcgcattcgttgtggccctaggagttgctgctgcctataagttt
ggcgtggctgaaccaagaaagaaggcttatgcagatttctacaggaattatgactccatg
aaagattttgaagagatgaggcaggctggtgtctttcagagtgcgaagtga

KEGG   Rattus norvegicus (rat): 654441
Entry
654441            CDS       T01003                                 

Gene name
Cox6b2
Definition
(RefSeq) cytochrome c oxidase subunit 6B2
  KO
K02267  cytochrome c oxidase subunit 6b
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04260  Cardiac muscle contraction
rno04714  Thermogenesis
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    654441 (Cox6b2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    654441 (Cox6b2)
  09159 Environmental adaptation
   04714 Thermogenesis
    654441 (Cox6b2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    654441 (Cox6b2)
   05012 Parkinson disease
    654441 (Cox6b2)
   05014 Amyotrophic lateral sclerosis
    654441 (Cox6b2)
   05016 Huntington disease
    654441 (Cox6b2)
   05020 Prion disease
    654441 (Cox6b2)
   05022 Pathways of neurodegeneration - multiple diseases
    654441 (Cox6b2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    654441 (Cox6b2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    654441 (Cox6b2)
SSDB
Motif
Pfam: COX6B CX9C
Other DBs
NCBI-GeneID: 654441
NCBI-ProteinID: NP_001034174
RGD: 1591896
Ensembl: ENSRNOG00000038616
UniProt: Q6YFQ1
Position
1
AA seq 88 aa
MLGVQAQMPAPGQWTTPPFDPRFPNQNQTRNCYQNFLDYHRCVKTMDRRGKNTQACDYYF
RVFHSLCPVSWVQRWNEQIKQGTFPGKI
NT seq 267 nt   +upstreamnt  +downstreamnt
atgttgggtgttcaagcccagatgcctgctccaggccaatggacaacgccgcccttcgac
ccgcgcttccctaaccaaaaccagacgcgtaactgctaccagaattttctggactaccac
cggtgtgtgaagaccatggatcgccgcggaaagaacacacaggcctgcgactactatttc
cgtgtattccattcactgtgtcccgtcagctgggtgcagcgctggaatgagcagatcaag
cagggaactttcccaggcaaaatctga

KEGG   Rattus norvegicus (rat): 687508
Entry
687508            CDS       T01003                                 

Definition
(RefSeq) cytochrome c oxidase subunit 7A1, mitochondrial isoform X2
  KO
K02270  cytochrome c oxidase subunit 7a
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04260  Cardiac muscle contraction
rno04714  Thermogenesis
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    687508
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    687508
  09159 Environmental adaptation
   04714 Thermogenesis
    687508
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    687508
   05012 Parkinson disease
    687508
   05014 Amyotrophic lateral sclerosis
    687508
   05016 Huntington disease
    687508
   05020 Prion disease
    687508
   05022 Pathways of neurodegeneration - multiple diseases
    687508
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    687508
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    687508
SSDB
Motif
Pfam: COX7a
Other DBs
NCBI-GeneID: 687508
NCBI-ProteinID: XP_003748883
RGD: 1584257
Ensembl: ENSRNOG00000050015
UniProt: M0R5K3
Position
1
AA seq 80 aa
MRALRVSQALIRSFTSSTRSHLENRVAQKQKLFQADNDLPVHLKGGGMDNILYRLTMTLT
LGGTAYCLYCLGWASFPHKK
NT seq 243 nt   +upstreamnt  +downstreamnt
atgagggccttacgggtctcccaggctctgatccggtcttttacctcatctaccaggagc
cacttagaaaaccgagtggcacagaagcagaagctcttccaggcagacaacgacctcccg
gtgcacttgaagggcgggggaatggacaacatcctgtacagactgaccatgacgctgacg
ctcgggggcactgcctactgtttatactgcttgggctgggcctccttcccccacaagaag
tga

KEGG   Rattus norvegicus (rat): 688386
Entry
688386            CDS       T01003                                 

Gene name
Cox7a2l2
Definition
(RefSeq) cytochrome c oxidase subunit 7A2, mitochondrial
  KO
K02270  cytochrome c oxidase subunit 7a
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04260  Cardiac muscle contraction
rno04714  Thermogenesis
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    688386 (Cox7a2l2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    688386 (Cox7a2l2)
  09159 Environmental adaptation
   04714 Thermogenesis
    688386 (Cox7a2l2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    688386 (Cox7a2l2)
   05012 Parkinson disease
    688386 (Cox7a2l2)
   05014 Amyotrophic lateral sclerosis
    688386 (Cox7a2l2)
   05016 Huntington disease
    688386 (Cox7a2l2)
   05020 Prion disease
    688386 (Cox7a2l2)
   05022 Pathways of neurodegeneration - multiple diseases
    688386 (Cox7a2l2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    688386 (Cox7a2l2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    688386 (Cox7a2l2)
SSDB
Motif
Pfam: COX7a
Other DBs
NCBI-GeneID: 688386
NCBI-ProteinID: XP_003751415
RGD: 1589992
Ensembl: ENSRNOG00000027791
UniProt: P35171 B2RYS0
Position
14
AA seq 83 aa
MLRNVLALRQIAQRTISTTSRRHFENKVPEKQKLFQEDNGMPVHLKGGTSDALLYRATML
LTVGGTAYAIYMLAMAAFPKKQN
NT seq 252 nt   +upstreamnt  +downstreamnt
atgctgcggaatgtgctggcccttcgtcagattgcccagaggaccatcagcaccacttca
cgaaggcattttgaaaacaaagttccagagaagcaaaagctgtttcaggaggataatggg
atgccagttcatctgaaaggcgggacatctgatgccctcctttacagagccacaatgctt
ctgacagttggtggaacagcgtatgccatctatatgttagctatggctgcattccccaag
aagcagaactga

KEGG   Rattus norvegicus (rat): 688869
Entry
688869            CDS       T01003                                 

Gene name
Cox6b1
Definition
(RefSeq) cytochrome c oxidase subunit 6B1
  KO
K02267  cytochrome c oxidase subunit 6b
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04260  Cardiac muscle contraction
rno04714  Thermogenesis
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    688869 (Cox6b1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    688869 (Cox6b1)
  09159 Environmental adaptation
   04714 Thermogenesis
    688869 (Cox6b1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    688869 (Cox6b1)
   05012 Parkinson disease
    688869 (Cox6b1)
   05014 Amyotrophic lateral sclerosis
    688869 (Cox6b1)
   05016 Huntington disease
    688869 (Cox6b1)
   05020 Prion disease
    688869 (Cox6b1)
   05022 Pathways of neurodegeneration - multiple diseases
    688869 (Cox6b1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    688869 (Cox6b1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    688869 (Cox6b1)
SSDB
Motif
Pfam: COX6B YozE_SAM_like
Other DBs
NCBI-GeneID: 688869
NCBI-ProteinID: NP_001138745
RGD: 1584097
Ensembl: ENSRNOG00000024309
UniProt: D3ZD09
Position
1
AA seq 86 aa
MAEDIKTKIKNYKTAPFDSRFPNQNQTKNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRV
YKSLCPVSWVSAWDDRIAEGTFPGKI
NT seq 261 nt   +upstreamnt  +downstreamnt
atggccgaagacatcaagactaaaatcaagaactacaaaaccgccccctttgacagccgc
ttcccaaaccagaaccagactaagaactgctggcagaactacctggacttccaccgctgt
gagaaggcaatgacggcaaagggcggtgacgtctccgtgtgcgagtggtaccggcgagtg
tacaagtccctctgccccgtctcatgggtctcagcctgggatgaccgcatagcagaaggc
acatttcctgggaagatctga

KEGG   Rattus norvegicus (rat): 84683
Entry
84683             CDS       T01003                                 

Gene name
Cox4i2
Definition
(RefSeq) cytochrome c oxidase subunit 4 isoform 2, mitochondrial isoform 2 precursor
  KO
K02263  cytochrome c oxidase subunit 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04260  Cardiac muscle contraction
rno04714  Thermogenesis
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    84683 (Cox4i2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    84683 (Cox4i2)
  09159 Environmental adaptation
   04714 Thermogenesis
    84683 (Cox4i2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    84683 (Cox4i2)
   05012 Parkinson disease
    84683 (Cox4i2)
   05014 Amyotrophic lateral sclerosis
    84683 (Cox4i2)
   05016 Huntington disease
    84683 (Cox4i2)
   05020 Prion disease
    84683 (Cox4i2)
   05022 Pathways of neurodegeneration - multiple diseases
    84683 (Cox4i2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    84683 (Cox4i2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    84683 (Cox4i2)
SSDB
Motif
Pfam: COX4
Other DBs
NCBI-GeneID: 84683
NCBI-ProteinID: NP_445924
RGD: 69422
Ensembl: ENSRNOG00000007827
UniProt: Q91Y94
Position
3
AA seq 172 aa
MFSRATRSLVMKTGGLRTQGTHSPGSAASSSQRRMTPYVDCYAQRSYPMPDEPYCTELSE
EQRALKEKEKGSWAQLSQAEKVALYRLQFHETFAEMNHRSNEWKTVMGCVFFFIGFTALV
IWWQRVYVFPKKVVTLTEERKAQQLQRLLDMKSNPIQGLSAHWDYEKKEWKK
NT seq 519 nt   +upstreamnt  +downstreamnt
atgttttccagagctacccggagtctggtaatgaagacaggaggactcagaactcaaggg
acacacagcccaggaagtgctgctagcagcagccagcggaggatgaccccctatgttgac
tgctatgctcagcgctcctatcccatgccggatgagccttactgcacagagctcagcgag
gagcagcgggccctgaaggagaaagagaagggcagctgggctcagctgagccaagcagag
aaggtggccttgtaccggctccagttccacgagaccttcgcagagatgaaccatcgctcc
aacgaatggaagacagtaatgggctgcgtcttcttcttcattggattcacggctctggtg
atttggtggcagcgggtctatgtgttccctaagaaggttgtcaccctgacggaagaacgg
aaagcccagcagctccagcgcctcctggacatgaagagcaaccccatacagggcctgtct
gcccactgggattacgagaagaaagagtggaaaaagtga

KEGG   Rattus norvegicus (rat): 94194
Entry
94194             CDS       T01003                                 

Gene name
Cox5b
Definition
(RefSeq) cytochrome c oxidase subunit 5B, mitochondrial precursor
  KO
K02265  cytochrome c oxidase subunit 5b
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04260  Cardiac muscle contraction
rno04714  Thermogenesis
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
Module
rno_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    94194 (Cox5b)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    94194 (Cox5b)
  09159 Environmental adaptation
   04714 Thermogenesis
    94194 (Cox5b)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    94194 (Cox5b)
   05012 Parkinson disease
    94194 (Cox5b)
   05014 Amyotrophic lateral sclerosis
    94194 (Cox5b)
   05016 Huntington disease
    94194 (Cox5b)
   05020 Prion disease
    94194 (Cox5b)
   05022 Pathways of neurodegeneration - multiple diseases
    94194 (Cox5b)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    94194 (Cox5b)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    94194 (Cox5b)
SSDB
Motif
Pfam: COX5B zf-RING_4 zinc_ribbon_5 VCIP135_N
Other DBs
NCBI-GeneID: 94194
NCBI-ProteinID: NP_446038
RGD: 620608
Ensembl: ENSRNOG00000016660
Vega: OTTRNOG00000000839
UniProt: P12075
Position
9
AA seq 129 aa
MASRLLRGVGALAAQALRAHGPRGVAATRSMASGGGVPTDEEQATGLEREIMIAAQRGLD
PYNMLPPKAASGTKEDPNLVPSVSNKRIVGCICEEDNCTVIWFWLHQGESQRCPNCGTHY
KLVPYQMVH
NT seq 390 nt   +upstreamnt  +downstreamnt
atggcttcaaggttacttcgcggagtaggcgctttggcggctcaggccctgagggcccac
ggaccccgtggcgtggccgctacccgctccatggcttctggaggtggtgtccctactgat
gaggagcaggctaccgggctggagagggagatcatgatagcagcacagaggggactggat
ccatacaatatgctacctccaaaggcagcttcgggcaccaaggaagaccccaatctagtc
ccatccgttagcaacaagagaatagtgggctgcatctgtgaagaggacaactgcactgtc
atctggttctggctgcaccaaggcgagagccagcgatgccccaactgtggaacacattac
aagttggtgccctaccaaatggtccactga

DBGET integrated database retrieval system