KEGG   Rattus norvegicus (rat): 100196907Help
Entry
100196907         CDS       T01003                                 

Gene name
Tmem59, Orf18, RGD1310313, Shd11
Definition
(RefSeq) transmembrane protein 59
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: BSMAP Ca_hom_mod
Motif
Other DBs
NCBI-GeneID: 100196907
NCBI-ProteinID: NP_001132937
RGD: 1310313
Ensembl: ENSRNOG00000009778
UniProt: D3ZTP3
Position
5q34
AA seq 323 aa AA seqDB search
MAAPKGKLWVQAQVGLPPLLLLTMALAGGSGTAAAEAFDSVLGDTASCHRACQLTYPLHT
YPKEEELYACQRGCRLFSICQFVDDGIDLNRTKLECESACTEAYSQPDEQYACHLGCQDQ
LPFAELRQEQLMSLMPRMHLLFPLTLVRSFWSDMMDSAQSFITSSWTFYLQADDGKIVIF
QSKPEIQYAPQLEQEPADLRQSSLSKMSYLQMRNSQAHRNYLEDEESDGFLRCLSLNSGW
ILTTTLVLSVMVLLWICCAAVATAVEQYVPPEKLSIYGDLEFMNEQKLSRYPAPSLVVVR
SQTEEHEEAGPLPTKVNLAHSEI
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgccaaaggggaagctttgggtccaggcccaggtggggctcccgccgctgctg
ctgctgaccatggcgctggccggaggctccggaactgcagcggccgaagcgtttgactcg
gtcctgggagacacggcgtcctgtcaccgagcctgtcagctgacctatcctttgcacacc
tacccgaaggaagaggagttatacgcatgtcagagaggctgcaggctgttttcaatttgc
cagttcgtggatgatggaattgatttaaatcgaaccaaactggaatgtgaatctgcgtgc
acagaagcgtattcccagcctgacgagcagtatgcgtgccatctcggctgccaggaccag
ttgccatttgctgaactgagacaagaacaactcatgtccctgatgccaaggatgcacctc
ctcttccctctgactctggtgaggtccttctggagcgacatgatggactctgcacagagc
ttcataacctcttcatggactttttatcttcaagctgatgatggaaaaatagtcatattc
cagtctaagccggaaattcagtatgcaccgcagttggagcaggagcctgcagacttaaga
cagtcatcgttaagcaaaatgtcctatctacagatgagaaactcccaagcacacaggaac
tacctggaagatgaagaaagcgatggctttttaagatgtctgtctcttaactctgggtgg
attttaactacgactctggtgctctcggtgatggtgttgctctggatctgctgtgcagct
gtggctacagccgtggagcaatacgtgccccctgagaagctgagtatctatggtgacttg
gagtttatgaatgaacaaaagctgagcagatatccagctccttccctcgtggttgtcagg
tctcagactgaagagcacgaggaggcggggcccctgcccaccaaggtgaatcttgctcac
tcagaaatctaa

DBGET integrated database retrieval system