KEGG   Rattus norvegicus (rat): 100233176
Entry
100233176         CDS       T01003                                 

Gene name
Gon7
Definition
(RefSeq) GON7, KEOPS complex subunit homolog
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: DUF4611 Sigma70_ner
Other DBs
NCBI-GeneID: 100233176
NCBI-ProteinID: NP_001136413
RGD: 2302582
Ensembl: ENSRNOG00000046085
UniProt: D3Z9A4
Position
6q32
AA seq 97 aa
MELSGEYVGGDGEPQRLQVSCEASSDADPLQSLSAGVVRMKELVAEFFGTLVEQDAQGVA
EDPEDALDGDEDDAEDENNSGRTNSDGPSAKRPKPTS
NT seq 294 nt   +upstreamnt  +downstreamnt
atggagctttctggcgagtatgtcggtggtgacggggagccgcagcggctacaagtgtcc
tgtgaagcgtcgagcgacgcggaccctctccagagcctgtcggcgggcgtggtccgcatg
aaggagttggtagcggagttcttcgggaccctagtggagcaggacgcacagggcgtggcg
gaagatccggaggacgctttggatggtgatgaagatgatgcagaagatgaaaataactct
ggtagaactaactcagatggaccatctgcaaaacgacctaaaccaacttcttaa

DBGET integrated database retrieval system